BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0031 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 25 0.69 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 25 0.91 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 23 2.1 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.1 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.1 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.8 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.4 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 6.4 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 6.4 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 6.4 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 6.4 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 6.4 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 6.4 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 8.5 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 8.5 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 8.5 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 8.5 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 8.5 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 8.5 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 8.5 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 8.5 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 25.0 bits (52), Expect = 0.69 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = -3 Query: 222 HNTYIQTKSINKICRKLHWYFFNIYSSIPLQSRITRALKGDFFSSLNLFNVFTYYYI*DT 43 ++T ++ + + +K+ YF P S+ + G F S+N+ ++TY+ DT Sbjct: 411 YSTSMRDPAFYMLYQKILSYFLRYKKLQPQYSQSELQMPGVKFESVNIDKLYTYFDKCDT 470 Query: 42 EDLNTV 25 N V Sbjct: 471 LINNAV 476 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 24.6 bits (51), Expect = 0.91 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 405 YEVKFILNNILYWKYL 452 + V FI+ NILYW ++ Sbjct: 452 FPVAFIIFNILYWSFI 467 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 231 DNHHNTYIQTKSINKICRKLHWYFFNIYSSIPL 133 DN + K I K + W+F ++ SSIPL Sbjct: 148 DNAEQVILDPKLIAKHYLRT-WFFLDLISSIPL 179 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 231 DNHHNTYIQTKSINKICRKLHWYFFNIYSSIPL 133 DN + K I K + W+F ++ SSIPL Sbjct: 148 DNAEQVILDPKLIAKHYLRT-WFFLDLISSIPL 179 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 231 DNHHNTYIQTKSINKICRKLHWYFFNIYSSIPL 133 DN + K I K + W+F ++ SSIPL Sbjct: 148 DNAEQVILDPKLIAKHYLRT-WFFLDLISSIPL 179 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/66 (22%), Positives = 30/66 (45%) Frame = -3 Query: 222 HNTYIQTKSINKICRKLHWYFFNIYSSIPLQSRITRALKGDFFSSLNLFNVFTYYYI*DT 43 ++T ++ + + + + YF P S+ + G F S+N+ ++TY+ DT Sbjct: 411 YSTSMRDPAFYMLYQNILSYFLRYKKLQPQYSQSELQMPGVKFESVNIDKLYTYFDKCDT 470 Query: 42 EDLNTV 25 N V Sbjct: 471 LINNAV 476 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 150 YSSIPLQSRITRALKGDFFSSLNLFNVFTY 61 Y+S+ R +R + FF ++N+F F Y Sbjct: 417 YNSVSKIDRASRIVFPLFFLAINVFYWFAY 446 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 228 NHHNTYIQTKSINKICRKLHWYFFNIYSSIPL 133 +++N Y N +KL +Y N IP+ Sbjct: 92 SNYNNYNNNNYNNNNYKKLQYYNINYIEQIPI 123 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 228 NHHNTYIQTKSINKICRKLHWYFFNIYSSIPL 133 +++N Y N +KL +Y N IP+ Sbjct: 92 SNYNNYNNNNYNNNNYKKLQYYNINYIEQIPI 123 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 228 NHHNTYIQTKSINKICRKLHWYFFNIYSSIPL 133 +++N Y N +KL +Y N IP+ Sbjct: 92 SNYNNYNNNNYNNNNYKKLQYYNINYIEQIPI 123 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 228 NHHNTYIQTKSINKICRKLHWYFFNIYSSIPL 133 +++N Y N +KL +Y N IP+ Sbjct: 92 SNYNNYNNNNYNNNNYKKLQYYNINYIEQIPI 123 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 208 NVCIMMIINRTDIRNLDRRPNRTRKKLDISGAEEYQRIY*DRYS 339 N ++ + +R DI + RR +R + Y+R DRY+ Sbjct: 101 NFPMISVFSRQDIETIIRRNSRYPLRPPQEVISHYRRTRRDRYT 144 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 419 KFYFVLSNTNNSKVLILI*PYL 354 KF+ +L+ TNN L+ + P L Sbjct: 257 KFHSILNRTNNIFELVTVEPIL 278 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 108 LQYYNIINIEQIPV 121 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 108 LQYYNIINIEQIPV 121 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 108 LQYYNIINIEQIPV 121 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 108 LQYYNIINIEQIPV 121 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 108 LQYYNIINIEQIPV 121 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 108 LQYYNIINIEQIPV 121 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 112 LQYYNIINIEQIPV 125 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 130 LEWYRRVNIEEVPM 171 L++Y +NIE++P+ Sbjct: 108 LQYYNIINIEQIPV 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,324 Number of Sequences: 438 Number of extensions: 3265 Number of successful extensions: 27 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -