BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0029 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 37 2e-04 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 33 0.002 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 28 0.063 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 25 0.78 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 25 0.78 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 25 0.78 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 23 3.1 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 4.1 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 22 4.1 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 22 4.1 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 5.5 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.2 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 7.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.6 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 36.7 bits (81), Expect = 2e-04 Identities = 33/156 (21%), Positives = 67/156 (42%), Gaps = 13/156 (8%) Frame = +2 Query: 167 TSLRDPTFWKMIEYYLNVMKYFRHFMDPFLMEEYTTEDFNIT-------GANFTKMETFF 325 T++RDP F++ Y ++ + ++ + + + ++ G++ TF+ Sbjct: 392 TAMRDPIFYRWHSYIDDIFQEYKATLPRYTENQLNYPGITVSNIEVQSQGSSKNTFNTFW 451 Query: 326 EYYRIPLNKILSAETGYISRKWPMFARQRRINHSPLTLNFTVDSKIDKN--VIVRLFLGP 499 + + L++ + + + +F R + H P T TV+++ + N R+FL P Sbjct: 452 QQSDVDLSRGMDFQP-----RGSVFVRFTHLQHQPFTYKITVNNQSNGNRKGTCRIFLAP 506 Query: 500 NC-SFNNCW---ERFEEFYELDIFNFTLHTGLNVIS 595 N W ++ F ELD F L G N I+ Sbjct: 507 KTDERGNPWLFRDQKIMFIELDKFTVNLKQGQNTIT 542 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 33.5 bits (73), Expect = 0.002 Identities = 35/161 (21%), Positives = 66/161 (40%), Gaps = 12/161 (7%) Frame = +2 Query: 149 VFYHPETSLRDPTFWKMIEYYLNVMKYFRHFMDPFLMEEYTTEDFNIT-------GANFT 307 V P LRDP F++ Y ++ + F+ + + + + +T G Sbjct: 386 VMADPAVDLRDPLFFRWHAYIDDMFQEFKATLPRYTVAQLNYPGVTVTNIEVQAKGGKPN 445 Query: 308 KMETFFEYYRIPLNKILSAETGYISRKWPMFARQRRINHSPLTLNFTVDSKIDKNV-IVR 484 + TF++ + L++ L + + +F R + + T TV++ + + R Sbjct: 446 VLSTFWQQSDLDLSRGLDFQP-----RGSVFVRFTHLQNQDFTYKITVNNSGNNRMGTCR 500 Query: 485 LFLGPNC-SFNNCW---ERFEEFYELDIFNFTLHTGLNVIS 595 +FL P N W + + F ELD F +L G N I+ Sbjct: 501 IFLAPQFDERGNPWLFRNQKDMFIELDRFAVSLKQGTNTIT 541 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 28.3 bits (60), Expect = 0.063 Identities = 13/53 (24%), Positives = 29/53 (54%) Frame = +2 Query: 119 PIDEYNPAPSVFYHPETSLRDPTFWKMIEYYLNVMKYFRHFMDPFLMEEYTTE 277 PID+Y P+ +FY+P T + ++Y+ +++ ++ PF ++ + E Sbjct: 95 PIDDYEPSFDLFYYPSRQ----TLYTPVQYFKDLVA--EAYVSPFRIDNESQE 141 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 24.6 bits (51), Expect = 0.78 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 364 SRQNFVQRYTIVFKKSFHFSKIGTSNIKI 278 +RQ + + T+ +K FHF+K T +I Sbjct: 186 TRQTYTRYQTLELEKEFHFNKYLTRRRRI 214 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 24.6 bits (51), Expect = 0.78 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 364 SRQNFVQRYTIVFKKSFHFSKIGTSNIKI 278 +RQ + + T+ +K FHF+K T +I Sbjct: 186 TRQTYTRYQTLELEKEFHFNKYLTRRRRI 214 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 24.6 bits (51), Expect = 0.78 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 364 SRQNFVQRYTIVFKKSFHFSKIGTSNIKI 278 +RQ + + T+ +K FHF+K T +I Sbjct: 186 TRQTYTRYQTLELEKEFHFNKYLTRRRRI 214 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 491 LGPNCSFNNCWERFEEFY 544 LGP C+ NN W + Y Sbjct: 257 LGPVCNSNNIWLHVDAAY 274 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 361 RQNFVQRYTIVFKKSFHFSK 302 R NF + +K FHF+K Sbjct: 257 RTNFTNKQLTELEKEFHFNK 276 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 361 RQNFVQRYTIVFKKSFHFSK 302 R NF + +K FHF+K Sbjct: 46 RTNFTNKQLTELEKEFHFNK 65 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 361 RQNFVQRYTIVFKKSFHFSK 302 R NF + +K FHF+K Sbjct: 46 RTNFTNKQLTELEKEFHFNK 65 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +2 Query: 86 REIFGNMRNRHPIDEYNPAPSVFYHPET--SLRDPTF 190 +EI G R ++E +P+P+ PE S RD F Sbjct: 99 QEIRGPKRKTWKVEEDSPSPTSSVSPEVKDSSRDRPF 135 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 7.2 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +3 Query: 597 GIHINQKNIH 626 G+H+ +KNIH Sbjct: 306 GVHLRKKNIH 315 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 592 DYVKSCM*SEVKNIQFVKLLKTFPTVVEA 506 DY + S + NI F+KL +P +++A Sbjct: 396 DYFVFLLCSILVNIAFIKLATEWPQLMKA 424 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 542 YELDIFNFTLHTGLNVISWNPHKSKKYSYFKD 637 Y + IF TL L + W ++YF+D Sbjct: 1236 YVIVIFLLTLKKDLLHLDWPFDPKVNFTYFED 1267 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 542 YELDIFNFTLHTGLNVISWNPHKSKKYSYFKD 637 Y + IF TL L + W ++YF+D Sbjct: 1236 YVIVIFLLTLKKDLLHLDWPFDPKVNFTYFED 1267 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,858 Number of Sequences: 336 Number of extensions: 3591 Number of successful extensions: 19 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -