BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0029 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7619| Best HMM Match : ArfGap (HMM E-Value=5.3) 32 0.51 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_7619| Best HMM Match : ArfGap (HMM E-Value=5.3) Length = 483 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 86 REIFGNMRNRHPIDEYNP 139 R FGN +N++P+DE+NP Sbjct: 426 RRAFGNYKNKYPVDEHNP 443 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/59 (23%), Positives = 24/59 (40%) Frame = +2 Query: 161 PETSLRDPTFWKMIEYYLNVMKYFRHFMDPFLMEEYTTEDFNITGANFTKMETFFEYYR 337 P + + D W + E + +K H MD L + E + ++ + E F Y R Sbjct: 148 PLSDVDDDLEWHLCEINMETVKRCAHLMDYLLQVDLVIESSGVQASSLMEEELFGRYDR 206 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,157,043 Number of Sequences: 59808 Number of extensions: 364923 Number of successful extensions: 882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -