BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0028 (559 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 24 3.9 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 24 3.9 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 23 5.1 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 23 6.8 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 9.0 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 9.0 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 503 NNLFSKWAVHKISLGTTDLDDKIXLXPFPVV 411 +N++ KW I +G + I PFP V Sbjct: 80 SNVYIKWQSSPIIIGLNPIATHIRNIPFPAV 110 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 503 NNLFSKWAVHKISLGTTDLDDKIXLXPFPVV 411 +N++ KW I +G + I PFP V Sbjct: 80 SNVYIKWQSSPIIIGLNPIATHIRNIPFPAV 110 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 23.4 bits (48), Expect = 5.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 282 LWILXLKFSLPFKYCLI 332 LWI K LP++ CLI Sbjct: 19 LWIFLEKTKLPYEKCLI 35 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 23.0 bits (47), Expect = 6.8 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +3 Query: 132 IMPSGQNPHQT 164 ++P+G NPHQT Sbjct: 10 MLPTGANPHQT 20 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 439 LSSKSVVPKLILCTAHFENKL 501 L++K + +L LC AH KL Sbjct: 1085 LATKHTIARLELCAAHLLGKL 1105 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 22.6 bits (46), Expect = 9.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 284 KHYTKIATDDFRYLPNFVYL 225 + Y KIA D R+ P VYL Sbjct: 205 RRYGKIAFDKLRHSPLVVYL 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,916 Number of Sequences: 2352 Number of extensions: 11159 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -