BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0026 (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 26 0.39 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 1.6 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 3.6 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 4.8 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 4.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.8 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 363 PAVDLDQTSKGCSVWYLCLTIVP 295 PA D+D+ + S W L L IVP Sbjct: 175 PAADVDEKTDANSWWALILVIVP 197 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 511 PPEHLHQKRTRTIFGVHYVQ 452 PP H H +T+++ +HY Q Sbjct: 349 PPHHHHHHQTQSLQHLHYRQ 368 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 22.6 bits (46), Expect = 3.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 292 HICYYGLILRSMCGSI 245 H C YG+ + S CG + Sbjct: 44 HKCKYGIAMSSACGIV 59 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 247 IYQPSKTGLISFADFHFITSDI 182 I PSK GL DF+ +DI Sbjct: 1 IRPPSKQGLPVLVDFNIFVADI 22 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 575 IFELATKIRGPQRLPKI 625 + ELA KI GP LP I Sbjct: 37 LLELAEKIPGPPALPLI 53 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 526 CRLSKESGNYRRAVETNLRIGDQNPRTPTIA 618 C+ E GN R+ + LR+ D T +A Sbjct: 31 CKWLSEGGNDTRSADCTLRVLDPGAITGLVA 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,674 Number of Sequences: 438 Number of extensions: 4071 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -