BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0022 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_18177| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_47829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +3 Query: 390 PFPKVTLAVVVGYFLGKLSYQQACAEKLMALPGSYIG-QILRDREEWKDWRDFNAST 557 P P LA++ GY + E M LP G +L + WKDW DF S+ Sbjct: 58 PTPVFFLALLTGYLCSSNRGCERTGEDSMLLPSVVNGLPVLVEPWRWKDWEDFTQSS 114 >SB_18177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 509 KRSGRMERLEGLQCQYRPLSMYGATTNDI 595 + S R + G+QC PLSMY TNDI Sbjct: 146 RNSLRFQADTGVQCNVVPLSMYKKATNDI 174 >SB_47829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 378 PRFGPFPKVTLAVVVGYFLGKL 443 PR PFPK LA+ +G F GK+ Sbjct: 49 PRLVPFPKRWLALTLGQFGGKI 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,739,992 Number of Sequences: 59808 Number of extensions: 426000 Number of successful extensions: 1024 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1023 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -