BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0020 (596 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15E1.10 ||SPAP7G5.01|PI31 proteasome regulator related|Schiz... 31 0.17 SPAC890.02c |alp7|mia1|TACC homolog |Schizosaccharomyces pombe|c... 27 1.6 SPBC15D4.01c ||SPBC2D10.21c|kinesin-like protein|Schizosaccharom... 25 6.3 SPAC821.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 8.4 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 25 8.4 >SPAC15E1.10 ||SPAP7G5.01|PI31 proteasome regulator related|Schizosaccharomyces pombe|chr 1|||Manual Length = 265 Score = 30.7 bits (66), Expect = 0.17 Identities = 26/77 (33%), Positives = 32/77 (41%), Gaps = 6/77 (7%) Frame = -3 Query: 429 GVNPDSQDLWAVPPGRNVGHSDLDPFSPFG------GGMIFNPFAPRRDIENPGLGVPGG 268 G P SQ ++ ++G SDL P G GGMI P EN Sbjct: 151 GAMPGSQPMFP-----SIGASDLYPAGIGGSDMGNDGGMIPTFNHPIFHPENRSRNEQAS 205 Query: 267 LPRAAVPPGARFDPFAP 217 R +PPGAR+DP P Sbjct: 206 ANRTNIPPGARYDPTGP 222 >SPAC890.02c |alp7|mia1|TACC homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 27.5 bits (58), Expect = 1.6 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 230 SKRAPGGTAALGNPPGTPRPGFSMSRRGANGLNIIPPPKGENGSRSEWPTLRP 388 S+R+P ++ N T GF R+GA+ ++IPP + + P L P Sbjct: 12 SRRSPSSSSIGTNE--TDHTGFHEKRQGASSESLIPPAQRSSEESMPAPKLFP 62 >SPBC15D4.01c ||SPBC2D10.21c|kinesin-like protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 633 Score = 25.4 bits (53), Expect = 6.3 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 266 NPPGTPRPGFSMSRRGANGLNIIPPPKGEN-GSRS 367 +P G+ + R AN I+PPP EN GS+S Sbjct: 371 DPFGSFDENAQVMRYSANAREILPPPLNENSGSQS 405 >SPAC821.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 485 Score = 25.0 bits (52), Expect = 8.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 414 SQDLWAVPPGRNVGHSDLDPFSPFGGGMIFNPFAP 310 + DL PGR V SDL P + F + + F P Sbjct: 179 TSDLPPSDPGRFVDDSDLTPHTDFTNRFVDSDFDP 213 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 25.0 bits (52), Expect = 8.4 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 369 SDLD-PFSPFGGGMIFNPFAPRRDIE 295 SDL+ PF PF G+ +P A + IE Sbjct: 360 SDLENPFVPFSSGLFVDPIASKVVIE 385 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,390,868 Number of Sequences: 5004 Number of extensions: 49698 Number of successful extensions: 141 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -