BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0015 (461 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0020 - 16504322-16504654,16504758-16504785,16504937-165049... 31 0.60 07_03_1537 + 27562097-27562340,27562436-27562494,27562605-275626... 27 5.6 07_03_1258 + 25244863-25245282,25246419-25246568,25246665-252468... 27 5.6 10_06_0143 - 11183574-11183761,11183989-11184344,11184437-111845... 27 9.7 >03_04_0020 - 16504322-16504654,16504758-16504785,16504937-16504989, 16505377-16505463,16505636-16505704,16506071-16506145, 16507040-16507210,16507693-16507793,16508062-16508139, 16508492-16508648,16508737-16509006,16509369-16509485, 16510250-16510339,16510417-16510629,16510742-16510891, 16511929-16512342 Length = 801 Score = 30.7 bits (66), Expect = 0.60 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 42 CAVSTCAVLQTLCAVYYVYLCIIFMCILC 128 C ++TC+ + CA+ V LC C+ C Sbjct: 761 CFINTCSKMNDRCAIVMVQLCGALSCLAC 789 >07_03_1537 + 27562097-27562340,27562436-27562494,27562605-27562680, 27562776-27562847,27562934-27563021,27563118-27563361, 27563490-27563605,27563783-27564000,27564113-27564144, 27564262-27564364,27564471-27564751 Length = 510 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 1 AAARLLLIVLAHRPVQYPPVQCY 69 AA RL L AH + PP QCY Sbjct: 6 AALRLALAAAAHLLLTLPPAQCY 28 >07_03_1258 + 25244863-25245282,25246419-25246568,25246665-25246877, 25246979-25247068,25247311-25247424,25247881-25248150, 25248251-25248407,25248691-25248741,25248742-25248819, 25249357-25249457,25249832-25250002,25250136-25250210, 25251527-25251793 Length = 718 Score = 27.5 bits (58), Expect = 5.6 Identities = 8/29 (27%), Positives = 13/29 (44%) Frame = +3 Query: 42 CAVSTCAVLQTLCAVYYVYLCIIFMCILC 128 C + C + CA+ +C F C+ C Sbjct: 677 CCIKACNKMNDQCAIVMTQVCAAFACLGC 705 >10_06_0143 - 11183574-11183761,11183989-11184344,11184437-11184592, 11184825-11184994,11185906-11186064,11186856-11187164, 11187281-11187576,11187825-11188174,11188279-11188434, 11188634-11188803,11189289-11189447,11190702-11191010, 11191172-11191458,11191911-11192263,11192366-11192521, 11192680-11192849,11195800-11195958,11196937-11197254, 11197658-11197786 Length = 1449 Score = 26.6 bits (56), Expect = 9.7 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 299 KSCEVLREHQTIRCLISPVKEISSNAV*AV 388 K+ EVLREH + L + K ISSN + AV Sbjct: 196 KATEVLREHWSTYILENDFKFISSNGLNAV 225 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,260,532 Number of Sequences: 37544 Number of extensions: 130703 Number of successful extensions: 299 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 919380308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -