BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0015 (461 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 22 9.1 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 22 9.1 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 9.1 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 364 YFFHRAYEATYSLVFP*NFTRFPVMVIIFLFRS 266 YF Y+ Y+++ FP++VI++ + S Sbjct: 202 YFEEEIYQIIYNVLVMCLMYTFPLIVILYCYGS 234 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 9.1 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 364 YFFHRAYEATYSLVFP*NFTRFPVMVIIFLFRS 266 YF Y+ Y+++ FP++VI++ + S Sbjct: 202 YFEEEIYQIIYNVLVMCLMYTFPLIVILYCYGS 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 386,013 Number of Sequences: 2352 Number of extensions: 6303 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -