Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0015
         (461 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY060474-1|AAL25513.1|  133|Drosophila melanogaster SD06722p pro...    30   1.3  

>AY060474-1|AAL25513.1|  133|Drosophila melanogaster SD06722p
           protein.
          Length = 133

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/49 (24%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +3

Query: 3   RREVATYRSRAQTCAVSTCAVLQTLCA-VYYVYLCIIFMCILCSLRSTD 146
           R E++ Y    Q+   + C     +C+ +YY+Y+ I    ++C+L+ ++
Sbjct: 52  RTEISLYTMIIQSEQFTQCMCCVCVCSQIYYLYIYIYISIVICTLKGSN 100


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,325,366
Number of Sequences: 53049
Number of extensions: 250191
Number of successful extensions: 640
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 632
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 640
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1539014778
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)