BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0012 (442 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0204 - 21559024-21559287,21559445-21559567,21559665-215597... 28 3.8 06_03_0635 - 22971502-22973840,22974112-22974403,22974639-229751... 27 8.8 >09_06_0204 - 21559024-21559287,21559445-21559567,21559665-21559718, 21559800-21560721,21560803-21561212,21561284-21561408, 21561524-21561571,21561668-21561789,21562008-21562099, 21562242-21562429,21562582-21562696,21562780-21562863, 21562994-21563087,21563393-21563510,21563805-21563930, 21564002-21564074,21564209-21564296,21564674-21564744, 21564839-21564918,21565004-21565065,21565169-21565310, 21565410-21565510,21565600-21565644,21565725-21565789, 21566088-21566163,21566246-21566300,21566416-21566773 Length = 1366 Score = 27.9 bits (59), Expect = 3.8 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +2 Query: 233 FTLEVIRSSIKKGPLIALGKHGRGRDFVPKPDDFSSKPLQVSKCHKSV*SANRALL 400 F + S K L L +HG D +P D +S PL++ +V S N+ +L Sbjct: 1107 FLVSCSSSLSSKFYLTYLWRHGPSADILPGKDFLASPPLKIKVMVCNVSSVNKMML 1162 >06_03_0635 - 22971502-22973840,22974112-22974403,22974639-22975162, 22975314-22975583,22976393-22977124,22977226-22977310 Length = 1413 Score = 26.6 bits (56), Expect = 8.8 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 221 NCTLDC*YP*ASVTTHHRMGRMLVCHCSPQKLVGRRDSTSVQENQ-DRV 78 NC + P A THH + L C CS +++ R D+ + + DRV Sbjct: 255 NCCMHKLSPSARGNTHHIGSQFLRCTCSCGRVLQREDTMKTPKLKFDRV 303 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,823,135 Number of Sequences: 37544 Number of extensions: 231766 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 835800280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -