BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0012 (442 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 4.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 4.5 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 237 HWKSFGARLKKDPS*RSG 290 HW G RL +PS R G Sbjct: 25 HWFRKGLRLHDNPSLREG 42 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 4.5 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = +3 Query: 231 PSHWKSFGARLKKDPS*RSGNTVEEETSFQSRMIFPLNLSKSQSVTKVYNQQT 389 P H LKK P R+ NT+ E +M ++Q + QQT Sbjct: 379 PQHPDILRELLKKIPDLRTLNTLHSEKLLAFKMTEQQQQMQAQQQHQQQQQQT 431 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,759 Number of Sequences: 438 Number of extensions: 2422 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -