BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0011 (418 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_26728| Best HMM Match : Disintegrin (HMM E-Value=1.9e-23) 29 1.2 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_10748| Best HMM Match : GETHR (HMM E-Value=1.5) 28 3.6 SB_40039| Best HMM Match : F5_F8_type_C (HMM E-Value=6.2e-12) 27 4.7 SB_13892| Best HMM Match : Protamine_P2 (HMM E-Value=2) 27 4.7 SB_4014| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_47269| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_30317| Best HMM Match : Protamine_3 (HMM E-Value=0.091) 27 6.2 SB_35277| Best HMM Match : WIF (HMM E-Value=9.8e-06) 27 8.2 SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) 27 8.2 SB_9952| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2835 Score = 30.7 bits (66), Expect = 0.50 Identities = 20/67 (29%), Positives = 26/67 (38%) Frame = +1 Query: 172 NNKDGSTISELPENWDQTKDDNRSLFLNKSDKNDLEPYPLALSEEGNQDGYDQTVDQRFD 351 +N DG S+ N D DDN S N D ND E+ + D D D D Sbjct: 27 DNDDGDDYSDSDHNDDDDDDDNDSDNNNVDDDNDGNDDDDDSDEDYDDDDNDDNDDDNDD 86 Query: 352 SPQSNGE 372 + N + Sbjct: 87 NDDDNDD 93 >SB_26728| Best HMM Match : Disintegrin (HMM E-Value=1.9e-23) Length = 1531 Score = 29.5 bits (63), Expect = 1.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 126 RYYSGPCCQRSADAFEQQRWQYH 194 RY+SGPCC RS + +++ + H Sbjct: 1498 RYFSGPCCNRSIASKIREKTEVH 1520 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 27.9 bits (59), Expect = 3.6 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +1 Query: 157 VPTPSNNKDGSTISELPENWDQTKDDNRSL--FLNKSDKNDLEPYPLALSEEGNQDGYDQ 330 V S+N D S +N D+ ++N + NKS+ ND + N DG+D Sbjct: 328 VDNNSHNNDEKNKSNSNDNNDENNNNNSNNKDSNNKSNNNDNKSNSNNTENNSNNDGFDN 387 Query: 331 TV 336 ++ Sbjct: 388 SI 389 >SB_10748| Best HMM Match : GETHR (HMM E-Value=1.5) Length = 126 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/65 (21%), Positives = 29/65 (44%) Frame = +1 Query: 178 KDGSTISELPENWDQTKDDNRSLFLNKSDKNDLEPYPLALSEEGNQDGYDQTVDQRFDSP 357 KDG T + W + N+S+ K +K ++E + + Q Q ++++ D Sbjct: 50 KDGKTKDGKTKRWKNKRWKNKSMEKQKMEKQEMEKQEMEKQKMEEQKMEKQKMEKQKDGK 109 Query: 358 QSNGE 372 +G+ Sbjct: 110 TKDGK 114 >SB_40039| Best HMM Match : F5_F8_type_C (HMM E-Value=6.2e-12) Length = 1093 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 265 KNDLEPYPLALSEEGNQDGYDQTVDQRF 348 + L Y LS + +QDGYDQ + + F Sbjct: 350 RKKLRGYKTRLSSQNSQDGYDQGMAENF 377 >SB_13892| Best HMM Match : Protamine_P2 (HMM E-Value=2) Length = 228 Score = 27.5 bits (58), Expect = 4.7 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +1 Query: 181 DGSTISELPENWDQTKDDNRSLFLNKSDKNDLEPYPLALSEEGNQDGYDQTVDQ 342 D S +SE + DQ DD + KSD++D+ P ++ + DG D +++ Sbjct: 77 DESDVSETDPSKDQYDDDGDDNEIEKSDESDV-PESDPSKDQYDDDGDDNELEK 129 >SB_4014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 151 SAVPTPSNNKDGSTISELPENWDQTKDDNRSLFLNK 258 S PT ++ K + + +N+ T DD S F+ K Sbjct: 15 STTPTKTSKKQNLKATPMKQNYSNTDDDQASSFVEK 50 >SB_47269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 27.1 bits (57), Expect = 6.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 136 AVLAVSAVPTPSNNKDGSTISELPENWDQTKDD 234 A A +A PS+ ST+ LP++WD DD Sbjct: 500 AAAAAAAASEPSSGGPSSTV--LPKHWDPIPDD 530 >SB_30317| Best HMM Match : Protamine_3 (HMM E-Value=0.091) Length = 761 Score = 27.1 bits (57), Expect = 6.2 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +1 Query: 103 TMLLFSLTAITAVLAVSAVPTPSNNKDGSTISELPENWDQTKDDN 237 T L T++ V+A PS DG T L NW + N Sbjct: 276 TTCLSGFTSLPGPSGVTAFSQPSRWDDGQTNRHLSNNWSPPSEAN 320 >SB_35277| Best HMM Match : WIF (HMM E-Value=9.8e-06) Length = 587 Score = 26.6 bits (56), Expect = 8.2 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +1 Query: 109 LLFSLTAITAVLAVSAVPTPSNNKDGSTISE 201 ++ + A + V ++P+PS NKD ++IS+ Sbjct: 305 VILVIALAVAAIHVHSMPSPSQNKDRASISD 335 >SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) Length = 933 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 175 NKDGSTISELPENWDQTKDDNRSLFLNKSDKNDLEPYPLALSEEGNQD 318 +++ STI P+ + +++D+R N D P + S+E N++ Sbjct: 640 SRNSSTIESSPKRFSWSQEDSRVQMRNSPAVTDGAPNRFSWSQENNKE 687 >SB_9952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 26.6 bits (56), Expect = 8.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 283 KVPNRFCHSCSRREIGYHLLFD 218 K+P+ C C R+ GY+ D Sbjct: 446 KIPDFLCKGCENRQYGYYAFLD 467 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,229,271 Number of Sequences: 59808 Number of extensions: 254182 Number of successful extensions: 886 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -