BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0006 (552 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0039 - 40667598-40669880 28 5.7 03_05_0258 - 22442527-22443927 27 7.5 >01_07_0039 - 40667598-40669880 Length = 760 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -2 Query: 344 LHNLTQCVTR*HTYRTDRDITTCFEL*IRLKPETLQMHRTARS 216 +HNL R ++R D+ T FEL PE LQ T+ S Sbjct: 458 IHNLLMFSHRIPSFRFTCDVGTVFELEHSAVPENLQYENTSAS 500 >03_05_0258 - 22442527-22443927 Length = 466 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 183 LPEIRNLWH-AHKLNKYQRIKGIFCFFFSIFN 91 LPE+ N WH ++N YQ+ + + S+FN Sbjct: 275 LPEVANYWHQVIRINDYQKSRFVNRVVSSMFN 306 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,565,482 Number of Sequences: 37544 Number of extensions: 193367 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -