BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0006 (552 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006677-4|AAF39949.1| 327|Caenorhabditis elegans Serpentine re... 27 9.0 >AC006677-4|AAF39949.1| 327|Caenorhabditis elegans Serpentine receptor, class g (gamma)protein 58 protein. Length = 327 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +2 Query: 266 KVRNRSLYRDRSGMYANVSRTVSGCGVSGELFWSFNSLIRIHFNSTPD 409 K+ + SL G N G +G L WS S + +FN PD Sbjct: 221 KIESMSLTNGGIGKKLNKIAVTYGSIYTGILLWSIISALNANFNFLPD 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,725,037 Number of Sequences: 27780 Number of extensions: 195816 Number of successful extensions: 488 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -