BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0004 (374 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 2.1 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 2.7 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 2.7 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 3.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 3.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 6.3 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 6.3 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 6.3 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 6.3 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 6.3 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 6.3 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 6.3 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 6.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 6.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 6.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.3 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 20 8.3 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 20 8.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 20 8.3 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 2.1 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 225 GALVEVIGSFSAHHFQLEVSVGVDAPGHDQFAS 127 G + + IG+F E +D PGH F S Sbjct: 176 GGITQCIGAFDVTLESGERVTFLDTPGHAAFIS 208 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 2.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 249 CPSGDRSPGALVEV 208 CP G ++PG L V Sbjct: 91 CPKGTKNPGTLATV 104 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 2.7 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -3 Query: 270 NEVNYGCCP 244 NE+ Y CCP Sbjct: 207 NEIYYNCCP 215 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 3.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 351 VVAAHLIIGFFPPIRVGL*KRLPFFR*NEVNY 256 + AA ++GFFP + + + R V Y Sbjct: 167 LTAASTVLGFFPALNIVADSFIELIRRQRVGY 198 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 3.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 82 GRNLIIPGGTRTIDAAGKLVMPGGID 159 G+ + P G ID A K + PG D Sbjct: 650 GKLKLPPDGRTEIDVAIKTLKPGSAD 675 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 133 IPPDMYRLRP 142 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 133 IPPDMYRLRP 142 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 133 IPPDMYRLRP 142 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 133 IPPDMYRLRP 142 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 133 IPPDMYRLRP 142 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 133 IPPDMYRLRP 142 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 133 IPPDMYRLRP 142 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 99 SWRHTDHRCRWQTG 140 SW + HRCR G Sbjct: 175 SWPYDTHRCRINFG 188 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 382 IPPDMYRLRP 391 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 382 IPPDMYRLRP 391 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 382 IPPDMYRLRP 391 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 382 IPPDMYRLRP 391 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 382 IPPDMYRLRP 391 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 382 IPPDMYRLRP 391 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 381 IPPDMYRLRP 390 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 366 IPPDMYRLRP 375 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 110 VPPGMMRLRP 81 +PP M RLRP Sbjct: 382 IPPDMYRLRP 391 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 20.2 bits (40), Expect = 8.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 190 PSFPARSECGGRCPRA*P 137 PS S C GRC R P Sbjct: 38 PSNEIFSRCDGRCQRFCP 55 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 20.2 bits (40), Expect = 8.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 190 PSFPARSECGGRCPRA*P 137 PS S C GRC R P Sbjct: 38 PSNEIFSRCDGRCQRFCP 55 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 20.2 bits (40), Expect = 8.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 120 DGPCASRNDEVAANLLD 70 DGP S +DE N LD Sbjct: 459 DGPTKSWSDESLNNALD 475 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,248 Number of Sequences: 438 Number of extensions: 2106 Number of successful extensions: 25 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9052365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -