BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0003 (317 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 0.52 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 0.52 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 22 4.8 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 210 AYSTPSRGEREPAEH*GNPITGDGYKSMNG 299 A S R + +PAEH G TGD + G Sbjct: 496 AQSAKQRTKSKPAEHAGGSTTGDKHNLFAG 525 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 210 AYSTPSRGEREPAEH*GNPITGDGYKSMNG 299 A S R + +PAEH G TGD + G Sbjct: 496 AQSAKQRTKSKPAEHAGGSTTGDKHNLFAG 525 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 22.2 bits (45), Expect = 4.8 Identities = 21/71 (29%), Positives = 27/71 (38%), Gaps = 5/71 (7%) Frame = -2 Query: 199 IILAGECVGLPPFISESPNWMLLRHGV----GDQWRNGSIARCLSEKSRVSVTR-TCRCV 35 II G G PFI E P+ +L + G + + I + TR T V Sbjct: 227 IIAPGSSEGSIPFIDEDPSQILRQLNANPQRGQNFHDARIITLTPKNVGSEATRATAAAV 286 Query: 34 ADDAWARHAVL 2 A D R A L Sbjct: 287 ASDQAHREAQL 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 373,406 Number of Sequences: 2352 Number of extensions: 8170 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 21181083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -