BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0002 (700 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089549-1|AAL90287.1| 328|Drosophila melanogaster LD24889p pro... 326 2e-89 AE014296-699|AAF47796.2| 328|Drosophila melanogaster CG1065-PA ... 326 2e-89 AY089508-1|AAL90246.1| 342|Drosophila melanogaster GH18334p pro... 265 3e-71 AM293919-1|CAL25829.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293918-1|CAL25828.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293917-1|CAL25827.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293916-1|CAL25826.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293915-1|CAL25825.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293914-1|CAL25824.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293913-1|CAL25823.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293912-1|CAL25822.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293911-1|CAL25821.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293910-1|CAL25820.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293909-1|CAL25819.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AM293908-1|CAL25818.1| 342|Drosophila melanogaster CG6255 protein. 265 3e-71 AE014297-2667|AAF55672.1| 342|Drosophila melanogaster CG6255-PA... 265 3e-71 Y09067-1|CAA70288.1| 110|Drosophila melanogaster succinyl coenz... 134 1e-31 BT015200-1|AAT94429.1| 1112|Drosophila melanogaster RE70805p pro... 38 0.013 AF132166-1|AAD34754.2| 1112|Drosophila melanogaster LD21334p pro... 38 0.013 AE013599-2154|AAM70940.1| 1086|Drosophila melanogaster CG8322-PB... 38 0.013 AE013599-2153|AAF58082.1| 1086|Drosophila melanogaster CG8322-PA... 38 0.013 AE014298-2775|AAF48890.1| 722|Drosophila melanogaster CG7095-PA... 30 2.6 AY461354-1|AAR85311.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461352-1|AAR85309.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461351-1|AAR85308.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461349-1|AAR85306.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461348-1|AAR85305.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461347-1|AAR85304.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461339-1|AAR85296.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461337-1|AAR85294.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461333-1|AAR85290.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461331-1|AAR85288.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461327-1|AAR85284.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461321-1|AAR85278.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461316-1|AAR85273.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461310-1|AAR85267.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461302-1|AAR85259.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461299-1|AAR85256.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461298-1|AAR85255.1| 1222|Drosophila melanogaster epidermal gr... 29 4.6 AY461295-1|AAR85252.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461294-1|AAR85251.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461291-1|AAR85248.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461282-1|AAR85239.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461280-1|AAR85237.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461274-1|AAR85232.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461270-1|AAR85228.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461267-1|AAR85225.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461264-1|AAR85222.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461251-1|AAR85209.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461250-1|AAR85208.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461245-1|AAR85203.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461243-1|AAR85201.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461232-1|AAR85190.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461230-1|AAR85188.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461228-1|AAR85186.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461226-1|AAR85184.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461225-1|AAR85183.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461221-1|AAR85179.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461220-1|AAR85178.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461215-1|AAR85173.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461213-1|AAR85171.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461212-1|AAR85170.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461210-1|AAR85168.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461197-1|AAR85155.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461196-1|AAR85154.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461188-1|AAR85146.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461183-1|AAR85141.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461174-1|AAR85132.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461156-1|AAR85114.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461136-1|AAR85094.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461133-1|AAR85091.1| 964|Drosophila melanogaster epidermal gr... 29 4.6 AY461130-1|AAR85088.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461124-1|AAR85082.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461122-1|AAR85080.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461117-1|AAR85075.1| 1315|Drosophila melanogaster epidermal gr... 29 4.6 AY461114-1|AAR85072.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461113-1|AAR85071.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461112-1|AAR85070.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461110-1|AAR85068.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461107-1|AAR85065.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461103-1|AAR85061.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461102-1|AAR85060.1| 1325|Drosophila melanogaster epidermal gr... 29 4.6 AY461236-1|AAR85194.1| 1325|Drosophila melanogaster epidermal gr... 29 6.1 K03054-1|AAA51462.1| 1283|Drosophila melanogaster EGFR protein. 29 8.0 BT003562-1|AAO39566.1| 1322|Drosophila melanogaster LP05058p pro... 29 8.0 AY461357-1|AAR85314.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461356-1|AAR85313.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461355-1|AAR85312.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461353-1|AAR85310.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461350-1|AAR85307.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461346-1|AAR85303.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461345-1|AAR85302.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461344-1|AAR85301.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461343-1|AAR85300.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461342-1|AAR85299.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461341-1|AAR85298.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461340-1|AAR85297.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461338-1|AAR85295.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461336-1|AAR85293.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461335-1|AAR85292.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461334-1|AAR85291.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461329-1|AAR85286.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461328-1|AAR85285.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461326-1|AAR85283.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461325-1|AAR85282.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461324-1|AAR85281.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461323-1|AAR85280.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461322-1|AAR85279.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461320-1|AAR85277.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461319-1|AAR85276.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461317-1|AAR85274.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461315-1|AAR85272.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461314-1|AAR85271.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461313-1|AAR85270.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461312-1|AAR85269.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461311-1|AAR85268.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461309-1|AAR85266.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461307-1|AAR85264.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461306-1|AAR85263.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461304-1|AAR85261.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461303-1|AAR85260.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461301-1|AAR85258.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461300-1|AAR85257.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461297-1|AAR85254.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461296-1|AAR85253.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461293-1|AAR85250.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461292-1|AAR85249.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461290-1|AAR85247.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461288-1|AAR85245.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461286-1|AAR85243.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461284-1|AAR85241.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461283-1|AAR85240.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461281-1|AAR85238.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461278-1|AAR85236.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461277-1|AAR85235.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461276-1|AAR85234.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461275-1|AAR85233.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461271-1|AAR85229.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461269-1|AAR85227.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461266-1|AAR85224.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461265-1|AAR85223.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461263-1|AAR85221.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461260-1|AAR85218.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461259-1|AAR85217.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461258-1|AAR85216.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461257-1|AAR85215.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461256-1|AAR85214.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461255-1|AAR85213.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461253-1|AAR85211.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461252-1|AAR85210.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461249-1|AAR85207.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461247-1|AAR85205.1| 1233|Drosophila melanogaster epidermal gr... 29 8.0 AY461246-1|AAR85204.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461244-1|AAR85202.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461242-1|AAR85200.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461241-1|AAR85199.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461240-1|AAR85198.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461239-1|AAR85197.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461235-1|AAR85193.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461234-1|AAR85192.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461233-1|AAR85191.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461231-1|AAR85189.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461229-1|AAR85187.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461227-1|AAR85185.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461224-1|AAR85182.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461223-1|AAR85181.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461222-1|AAR85180.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461218-1|AAR85176.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461217-1|AAR85175.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461211-1|AAR85169.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461209-1|AAR85167.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461208-1|AAR85166.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461207-1|AAR85165.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461206-1|AAR85164.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461205-1|AAR85163.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461204-1|AAR85162.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461203-1|AAR85161.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461202-1|AAR85160.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461201-1|AAR85159.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461200-1|AAR85158.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461199-1|AAR85157.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461198-1|AAR85156.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461195-1|AAR85153.1| 883|Drosophila melanogaster epidermal gr... 29 8.0 AY461194-1|AAR85152.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461193-1|AAR85151.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461192-1|AAR85150.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461191-1|AAR85149.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461190-1|AAR85148.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461189-1|AAR85147.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461187-1|AAR85145.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461186-1|AAR85144.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461185-1|AAR85143.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461181-1|AAR85139.1| 892|Drosophila melanogaster epidermal gr... 29 8.0 AY461171-1|AAR85129.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461168-1|AAR85126.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461166-1|AAR85124.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461164-1|AAR85122.1| 1268|Drosophila melanogaster epidermal gr... 29 8.0 AY461162-1|AAR85120.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461144-1|AAR85102.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461141-1|AAR85099.1| 1276|Drosophila melanogaster epidermal gr... 29 8.0 AY461140-1|AAR85098.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461134-1|AAR85092.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461132-1|AAR85090.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461131-1|AAR85089.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461129-1|AAR85087.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461128-1|AAR85086.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461127-1|AAR85085.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461126-1|AAR85084.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461123-1|AAR85081.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461121-1|AAR85079.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461118-1|AAR85076.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461116-1|AAR85074.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461115-1|AAR85073.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461111-1|AAR85069.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461109-1|AAR85067.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461108-1|AAR85066.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461106-1|AAR85064.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461105-1|AAR85063.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AY461104-1|AAR85062.1| 1325|Drosophila melanogaster epidermal gr... 29 8.0 AF109080-1|AAD26135.1| 1326|Drosophila melanogaster mutant epide... 29 8.0 AF109079-2|AAD26131.1| 1426|Drosophila melanogaster mutant epide... 29 8.0 AF109079-1|AAD26130.1| 1377|Drosophila melanogaster mutant epide... 29 8.0 AF109078-2|AAD26133.1| 1426|Drosophila melanogaster mutant epide... 29 8.0 AF109078-1|AAD26132.1| 1377|Drosophila melanogaster mutant epide... 29 8.0 AF109077-1|AAD26134.1| 1326|Drosophila melanogaster epidermal gr... 29 8.0 AF052754-2|AAC08536.1| 1426|Drosophila melanogaster epidermal gr... 29 8.0 AF052754-1|AAC08535.1| 1377|Drosophila melanogaster epidermal gr... 29 8.0 AE013599-3226|AAF46732.1| 1426|Drosophila melanogaster CG10079-P... 29 8.0 AE013599-3221|AAM70919.1| 1377|Drosophila melanogaster CG10079-P... 29 8.0 >AY089549-1|AAL90287.1| 328|Drosophila melanogaster LD24889p protein. Length = 328 Score = 326 bits (801), Expect = 2e-89 Identities = 158/224 (70%), Positives = 176/224 (78%) Frame = +2 Query: 29 MAMPVRVLSKFKDGLKLGNVRFASGNPYAETRKNLILTSETKVIVQGFTGKQGTFHSQQA 208 MA +R L K +DG G VR S Y +TR NL L +++VI QGFTGKQGTFHSQQA Sbjct: 1 MAASMRALLKVRDGFVAG-VRCNS--QYNKTRGNLKLNGDSRVICQGFTGKQGTFHSQQA 57 Query: 209 LDYGTKVVGGVSPKKAGTEHLGKPVFGTVKEAKAGTGATASVIYVPPPGXXXXXXXXXXX 388 L+YGTK+VGG+SPKK GT+HLG PVF +V EAK T A+VIYVPPPG Sbjct: 58 LEYGTKLVGGISPKKGGTQHLGLPVFASVAEAKKATDPHATVIYVPPPGAAAAIIEALEA 117 Query: 389 XMPLIVCITEGVPQHDMVRVKHALLRQNKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGC 568 +PLIVCITEGVPQHDMV+VKHAL+ Q+KSRLVGPNCPGIIAPE+CKIGIMP +HKRG Sbjct: 118 EIPLIVCITEGVPQHDMVKVKHALISQSKSRLVGPNCPGIIAPEQCKIGIMPGHIHKRGK 177 Query: 569 IGVVSRSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 IGVVSRSGTLTYEA HQTT GLGQTLCVGIGGDPFNGTDFIDC Sbjct: 178 IGVVSRSGTLTYEAVHQTTEVGLGQTLCVGIGGDPFNGTDFIDC 221 >AE014296-699|AAF47796.2| 328|Drosophila melanogaster CG1065-PA protein. Length = 328 Score = 326 bits (801), Expect = 2e-89 Identities = 158/224 (70%), Positives = 176/224 (78%) Frame = +2 Query: 29 MAMPVRVLSKFKDGLKLGNVRFASGNPYAETRKNLILTSETKVIVQGFTGKQGTFHSQQA 208 MA +R L K +DG G VR S Y +TR NL L +++VI QGFTGKQGTFHSQQA Sbjct: 1 MAASMRALLKVRDGFVAG-VRCNS--QYNKTRGNLKLNGDSRVICQGFTGKQGTFHSQQA 57 Query: 209 LDYGTKVVGGVSPKKAGTEHLGKPVFGTVKEAKAGTGATASVIYVPPPGXXXXXXXXXXX 388 L+YGTK+VGG+SPKK GT+HLG PVF +V EAK T A+VIYVPPPG Sbjct: 58 LEYGTKLVGGISPKKGGTQHLGLPVFASVAEAKKATDPHATVIYVPPPGAAAAIIEALEA 117 Query: 389 XMPLIVCITEGVPQHDMVRVKHALLRQNKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGC 568 +PLIVCITEGVPQHDMV+VKHAL+ Q+KSRLVGPNCPGIIAPE+CKIGIMP +HKRG Sbjct: 118 EIPLIVCITEGVPQHDMVKVKHALISQSKSRLVGPNCPGIIAPEQCKIGIMPGHIHKRGK 177 Query: 569 IGVVSRSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 IGVVSRSGTLTYEA HQTT GLGQTLCVGIGGDPFNGTDFIDC Sbjct: 178 IGVVSRSGTLTYEAVHQTTEVGLGQTLCVGIGGDPFNGTDFIDC 221 >AY089508-1|AAL90246.1| 342|Drosophila melanogaster GH18334p protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293919-1|CAL25829.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293918-1|CAL25828.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293917-1|CAL25827.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293916-1|CAL25826.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293915-1|CAL25825.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293914-1|CAL25824.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293913-1|CAL25823.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293912-1|CAL25822.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293911-1|CAL25821.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293910-1|CAL25820.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293909-1|CAL25819.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AM293908-1|CAL25818.1| 342|Drosophila melanogaster CG6255 protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >AE014297-2667|AAF55672.1| 342|Drosophila melanogaster CG6255-PA protein. Length = 342 Score = 265 bits (650), Expect = 3e-71 Identities = 121/196 (61%), Positives = 146/196 (74%) Frame = +2 Query: 110 YAETRKNLILTSETKVIVQGFTGKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFG 289 Y +T NL + TKV+VQGFTGKQ TFHS++++ YGT +VGGV+PKK GTEHLGKPVF Sbjct: 26 YGKTVCNLKINKATKVLVQGFTGKQATFHSEESIKYGTNIVGGVNPKKGGTEHLGKPVFK 85 Query: 290 TVKEAKAGTGATASVIYVPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKHALLRQ 469 +V EA A+VI++PPP + LIV ITEG+PQ DMVR+ L Q Sbjct: 86 SVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEIGLIVAITEGIPQADMVRISQMLNCQ 145 Query: 470 NKSRLVGPNCPGIIAPEKCKIGIMPAAVHKRGCIGVVSRSGTLTYEACHQTTITGLGQTL 649 KSRL+GPNCPGII+P++CKIGIMP +HKRG +G+VSRSGTLTYE+ HQTT GLGQ L Sbjct: 146 EKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVGIVSRSGTLTYESVHQTTNVGLGQAL 205 Query: 650 CVGIGGDPFNGTDFID 697 CVG+GGDPFNGT FID Sbjct: 206 CVGLGGDPFNGTSFID 221 >Y09067-1|CAA70288.1| 110|Drosophila melanogaster succinyl coenzyme A synthetasealpha subunit protein. Length = 110 Score = 134 bits (323), Expect = 1e-31 Identities = 68/109 (62%), Positives = 80/109 (73%) Frame = +2 Query: 29 MAMPVRVLSKFKDGLKLGNVRFASGNPYAETRKNLILTSETKVIVQGFTGKQGTFHSQQA 208 MA +R L K +DG G VR S Y +TR NL L +++VI QGFTGKQGTFHSQQA Sbjct: 1 MAASMRALLKVRDGFVAG-VRCNS--QYNKTRGNLKLNGDSRVICQGFTGKQGTFHSQQA 57 Query: 209 LDYGTKVVGGVSPKKAGTEHLGKPVFGTVKEAKAGTGATASVIYVPPPG 355 L+YGTK+VGG+SPKK GT+HLG PVF +V EAK T A+VIYVPPPG Sbjct: 58 LEYGTKLVGGISPKKGGTQHLGLPVFASVAEAKKATDPHATVIYVPPPG 106 >BT015200-1|AAT94429.1| 1112|Drosophila melanogaster RE70805p protein. Length = 1112 Score = 37.9 bits (84), Expect = 0.013 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 8/107 (7%) Frame = +2 Query: 401 IVCITEGVPQHDMVRVKHALLRQNKSRLVGPNCPGIIAPEKCKIG--------IMPAAVH 556 + I EG+P++ M R + ++GP G + P KIG I+ + ++ Sbjct: 606 VAIIAEGIPEN-MTRKLIIEADKKGVAIIGPATVGGVKPGCFKIGNTGGMLDNILHSKLY 664 Query: 557 KRGCIGVVSRSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFID 697 + G + VSRSG ++ E + + G + IGGD + G+ F+D Sbjct: 665 RPGSVAYVSRSGGMSNELNNIISKATDGVIEGIAIGGDRYPGSTFMD 711 >AF132166-1|AAD34754.2| 1112|Drosophila melanogaster LD21334p protein. Length = 1112 Score = 37.9 bits (84), Expect = 0.013 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 8/107 (7%) Frame = +2 Query: 401 IVCITEGVPQHDMVRVKHALLRQNKSRLVGPNCPGIIAPEKCKIG--------IMPAAVH 556 + I EG+P++ M R + ++GP G + P KIG I+ + ++ Sbjct: 606 VAIIAEGIPEN-MTRKLIIEADKKGVAIIGPATVGGVKPGCFKIGNTGGMLDNILHSKLY 664 Query: 557 KRGCIGVVSRSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFID 697 + G + VSRSG ++ E + + G + IGGD + G+ F+D Sbjct: 665 RPGSVAYVSRSGGMSNELNNIISKATDGVIEGIAIGGDRYPGSTFMD 711 >AE013599-2154|AAM70940.1| 1086|Drosophila melanogaster CG8322-PB, isoform B protein. Length = 1086 Score = 37.9 bits (84), Expect = 0.013 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 8/107 (7%) Frame = +2 Query: 401 IVCITEGVPQHDMVRVKHALLRQNKSRLVGPNCPGIIAPEKCKIG--------IMPAAVH 556 + I EG+P++ M R + ++GP G + P KIG I+ + ++ Sbjct: 580 VAIIAEGIPEN-MTRKLIIEADKKGVAIIGPATVGGVKPGCFKIGNTGGMLDNILHSKLY 638 Query: 557 KRGCIGVVSRSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFID 697 + G + VSRSG ++ E + + G + IGGD + G+ F+D Sbjct: 639 RPGSVAYVSRSGGMSNELNNIISKATDGVIEGIAIGGDRYPGSTFMD 685 >AE013599-2153|AAF58082.1| 1086|Drosophila melanogaster CG8322-PA, isoform A protein. Length = 1086 Score = 37.9 bits (84), Expect = 0.013 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 8/107 (7%) Frame = +2 Query: 401 IVCITEGVPQHDMVRVKHALLRQNKSRLVGPNCPGIIAPEKCKIG--------IMPAAVH 556 + I EG+P++ M R + ++GP G + P KIG I+ + ++ Sbjct: 580 VAIIAEGIPEN-MTRKLIIEADKKGVAIIGPATVGGVKPGCFKIGNTGGMLDNILHSKLY 638 Query: 557 KRGCIGVVSRSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFID 697 + G + VSRSG ++ E + + G + IGGD + G+ F+D Sbjct: 639 RPGSVAYVSRSGGMSNELNNIISKATDGVIEGIAIGGDRYPGSTFMD 685 >AE014298-2775|AAF48890.1| 722|Drosophila melanogaster CG7095-PA protein. Length = 722 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 233 GGVS-PKKAGTEHLG-KPVFGTVKEAKAGTGATASVIYVPPPG 355 GGVS KK T L +P G + +GT A +S++ PPPG Sbjct: 633 GGVSGAKKKMTAALSSQPNLGDAAKGPSGTSAGSSMMQAPPPG 675 >AY461354-1|AAR85311.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461352-1|AAR85309.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461351-1|AAR85308.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461349-1|AAR85306.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461348-1|AAR85305.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461347-1|AAR85304.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461339-1|AAR85296.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461337-1|AAR85294.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461333-1|AAR85290.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461331-1|AAR85288.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461327-1|AAR85284.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461321-1|AAR85278.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461316-1|AAR85273.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461310-1|AAR85267.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461302-1|AAR85259.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461299-1|AAR85256.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461298-1|AAR85255.1| 1222|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1222 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461295-1|AAR85252.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461294-1|AAR85251.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461291-1|AAR85248.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461282-1|AAR85239.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461280-1|AAR85237.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461274-1|AAR85232.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461270-1|AAR85228.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461267-1|AAR85225.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461264-1|AAR85222.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461251-1|AAR85209.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461250-1|AAR85208.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461245-1|AAR85203.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461243-1|AAR85201.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461232-1|AAR85190.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461230-1|AAR85188.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461228-1|AAR85186.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461226-1|AAR85184.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461225-1|AAR85183.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461221-1|AAR85179.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461220-1|AAR85178.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461215-1|AAR85173.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461213-1|AAR85171.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461212-1|AAR85170.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461210-1|AAR85168.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461197-1|AAR85155.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461196-1|AAR85154.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461188-1|AAR85146.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461183-1|AAR85141.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461174-1|AAR85132.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461156-1|AAR85114.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461136-1|AAR85094.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461133-1|AAR85091.1| 964|Drosophila melanogaster epidermal growth factor receptor protein. Length = 964 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 132 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 170 >AY461130-1|AAR85088.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461124-1|AAR85082.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461122-1|AAR85080.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461117-1|AAR85075.1| 1315|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1315 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461114-1|AAR85072.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461113-1|AAR85071.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461112-1|AAR85070.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461110-1|AAR85068.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461107-1|AAR85065.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461103-1|AAR85061.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461102-1|AAR85060.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADC 505 >AY461236-1|AAR85194.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGXWGAGTDQCLXCKNFNFNGTCIADC 505 >K03054-1|AAA51462.1| 1283|Drosophila melanogaster EGFR protein. Length = 1283 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 393 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 431 >BT003562-1|AAO39566.1| 1322|Drosophila melanogaster LP05058p protein. Length = 1322 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 464 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 502 >AY461357-1|AAR85314.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461356-1|AAR85313.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461355-1|AAR85312.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461353-1|AAR85310.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461350-1|AAR85307.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461346-1|AAR85303.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461345-1|AAR85302.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461344-1|AAR85301.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461343-1|AAR85300.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461342-1|AAR85299.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461341-1|AAR85298.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461340-1|AAR85297.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461338-1|AAR85295.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461336-1|AAR85293.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461335-1|AAR85292.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461334-1|AAR85291.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461329-1|AAR85286.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461328-1|AAR85285.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461326-1|AAR85283.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461325-1|AAR85282.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461324-1|AAR85281.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461323-1|AAR85280.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461322-1|AAR85279.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461320-1|AAR85277.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461319-1|AAR85276.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461317-1|AAR85274.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461315-1|AAR85272.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461314-1|AAR85271.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461313-1|AAR85270.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461312-1|AAR85269.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461311-1|AAR85268.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461309-1|AAR85266.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461307-1|AAR85264.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461306-1|AAR85263.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461304-1|AAR85261.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461303-1|AAR85260.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461301-1|AAR85258.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461300-1|AAR85257.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461297-1|AAR85254.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461296-1|AAR85253.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461293-1|AAR85250.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461292-1|AAR85249.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461290-1|AAR85247.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461288-1|AAR85245.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461286-1|AAR85243.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461284-1|AAR85241.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461283-1|AAR85240.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461281-1|AAR85238.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461278-1|AAR85236.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461277-1|AAR85235.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461276-1|AAR85234.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461275-1|AAR85233.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461271-1|AAR85229.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461269-1|AAR85227.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461266-1|AAR85224.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461265-1|AAR85223.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461263-1|AAR85221.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461260-1|AAR85218.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461259-1|AAR85217.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461258-1|AAR85216.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461257-1|AAR85215.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461256-1|AAR85214.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461255-1|AAR85213.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461253-1|AAR85211.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461252-1|AAR85210.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461249-1|AAR85207.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461247-1|AAR85205.1| 1233|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1233 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461246-1|AAR85204.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461244-1|AAR85202.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461242-1|AAR85200.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461241-1|AAR85199.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461240-1|AAR85198.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461239-1|AAR85197.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461235-1|AAR85193.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461234-1|AAR85192.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461233-1|AAR85191.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461231-1|AAR85189.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461229-1|AAR85187.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461227-1|AAR85185.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461224-1|AAR85182.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461223-1|AAR85181.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461222-1|AAR85180.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461218-1|AAR85176.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461217-1|AAR85175.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461211-1|AAR85169.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461209-1|AAR85167.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461208-1|AAR85166.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461207-1|AAR85165.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461206-1|AAR85164.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461205-1|AAR85163.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461204-1|AAR85162.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461203-1|AAR85161.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461202-1|AAR85160.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461201-1|AAR85159.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461200-1|AAR85158.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461199-1|AAR85157.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461198-1|AAR85156.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461195-1|AAR85153.1| 883|Drosophila melanogaster epidermal growth factor receptor protein. Length = 883 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461194-1|AAR85152.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461193-1|AAR85151.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461192-1|AAR85150.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461191-1|AAR85149.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461190-1|AAR85148.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461189-1|AAR85147.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461187-1|AAR85145.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461186-1|AAR85144.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461185-1|AAR85143.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461181-1|AAR85139.1| 892|Drosophila melanogaster epidermal growth factor receptor protein. Length = 892 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461171-1|AAR85129.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461168-1|AAR85126.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461166-1|AAR85124.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461164-1|AAR85122.1| 1268|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1268 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461162-1|AAR85120.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461144-1|AAR85102.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461141-1|AAR85099.1| 1276|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1276 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461140-1|AAR85098.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDXCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461134-1|AAR85092.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461132-1|AAR85090.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461131-1|AAR85089.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461129-1|AAR85087.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461128-1|AAR85086.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461127-1|AAR85085.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461126-1|AAR85084.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461123-1|AAR85081.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461121-1|AAR85079.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461118-1|AAR85076.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461116-1|AAR85074.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461115-1|AAR85073.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461111-1|AAR85069.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461109-1|AAR85067.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461108-1|AAR85066.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461106-1|AAR85064.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461105-1|AAR85063.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AY461104-1|AAR85062.1| 1325|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1325 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 467 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 505 >AF109080-1|AAD26135.1| 1326|Drosophila melanogaster mutant epidermal growth factorreceptor protein. Length = 1326 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 468 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 506 >AF109079-2|AAD26131.1| 1426|Drosophila melanogaster mutant epidermal growth factorreceptor isoform I protein. Length = 1426 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 568 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 606 >AF109079-1|AAD26130.1| 1377|Drosophila melanogaster mutant epidermal growth factorreceptor isoform II protein. Length = 1377 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 519 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 557 >AF109078-2|AAD26133.1| 1426|Drosophila melanogaster mutant epidermal growth factorreceptor isoform I protein. Length = 1426 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 568 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 606 >AF109078-1|AAD26132.1| 1377|Drosophila melanogaster mutant epidermal growth factorreceptor isoform II protein. Length = 1377 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 519 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 557 >AF109077-1|AAD26134.1| 1326|Drosophila melanogaster epidermal growth factor receptor protein. Length = 1326 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 468 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 506 >AF052754-2|AAC08536.1| 1426|Drosophila melanogaster epidermal growth factor receptorisoform I protein. Length = 1426 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 568 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 606 >AF052754-1|AAC08535.1| 1377|Drosophila melanogaster epidermal growth factor receptorisoform II protein. Length = 1377 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 519 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 557 >AE013599-3226|AAF46732.1| 1426|Drosophila melanogaster CG10079-PB, isoform B protein. Length = 1426 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 568 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 606 >AE013599-3221|AAM70919.1| 1377|Drosophila melanogaster CG10079-PA, isoform A protein. Length = 1377 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 584 RSGTLTYEACHQTTITGLGQTLCVGIGGDPFNGTDFIDC 700 ++GT+ + C++ G G C+ FNGT DC Sbjct: 519 KNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC 557 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,559,134 Number of Sequences: 53049 Number of extensions: 710227 Number of successful extensions: 1843 Number of sequences better than 10.0: 229 Number of HSP's better than 10.0 without gapping: 1742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1843 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -