BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0002 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 25 0.91 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.9 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.5 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.5 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 24.6 bits (51), Expect = 0.91 Identities = 13/53 (24%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 116 ETRKNLILTSETKVIVQGFTGKQGTFHSQQAL-DYGTKVVGGVSPKKAGTEHL 271 + R L +T ++ + ++ + Q++ DY + + V KKAG++HL Sbjct: 287 DLRSQLEYDLQTSIMSRHYSTRAIVIEKGQSIWDYDSTYIPKVKNKKAGSKHL 339 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 566 CIGVVSRSGTLTYEACHQTTITGLGQTLC 652 CIG + S ++ + TT +G+ + LC Sbjct: 126 CIGRIQWSKLQVFDCRYVTTTSGMFEALC 154 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 2 RRFTFNNSTMAMPVRVLSKFKDGLKLG 82 R TF + P++ +S KDG LG Sbjct: 323 RPATFTCNVRGNPIKTVSWLKDGKPLG 349 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 315 IPSHYIEQIPVPVYYGNFPPRPIM 338 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -2 Query: 291 VPNTGLPRCSVPAFFGDTPPTTLV 220 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,991 Number of Sequences: 438 Number of extensions: 4244 Number of successful extensions: 22 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -