SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-2495
         (647 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF008575-1|AAB87764.1|  525|Anopheles gambiae chitinase protein.       30   0.073
AY278446-1|AAP37003.1|  151|Anopheles gambiae microsomal glutath...    23   8.3  

>AF008575-1|AAB87764.1|  525|Anopheles gambiae chitinase protein.
          Length = 525

 Score = 29.9 bits (64), Expect = 0.073
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 6/57 (10%)
 Frame = +2

Query: 26  MTWAIDMDDFKGLC-GEENPLIKLLHKHM-----STYTVPPARTGHATPTPVMGAST 178
           M W+++ DDF G+C G   PL+  +   +     ST T+PP+     T T   G +T
Sbjct: 371 MVWSLETDDFLGVCGGGRYPLMHEIRSLVNGGTPSTTTMPPS-VAPTTSTVAPGTTT 426


>AY278446-1|AAP37003.1|  151|Anopheles gambiae microsomal
           glutathione transferase GSTMIC1protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = +2

Query: 2   LVPNSARGMTWAI 40
           ++P  ARG++WAI
Sbjct: 122 VIPQPARGLSWAI 134


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 570,857
Number of Sequences: 2352
Number of extensions: 10977
Number of successful extensions: 23
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63977715
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -