BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-2298
(750 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
05_01_0299 - 2322204-2322734,2324089-2326164 29 3.9
>05_01_0299 - 2322204-2322734,2324089-2326164
Length = 868
Score = 29.1 bits (62), Expect = 3.9
Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%)
Frame = -1
Query: 456 KMRSFPSASXSXVKLMLLM----KANLKFPWSPSNLXXNSXXXLPFNPCXNALVNVSFNP 289
K RSF ++ S +K + A++K P P +L LP NP +A ++ + NP
Sbjct: 404 KCRSFSDSTTSSLKASSKVGKGFSASMKGPEVPPDLSFTGAA-LPSNPSFDAKLSSNLNP 462
Query: 288 LPS 280
LP+
Sbjct: 463 LPA 465
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,304,394
Number of Sequences: 37544
Number of extensions: 210337
Number of successful extensions: 329
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 327
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 329
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1992480932
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -