Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-2214
         (750 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578800-1|AAT07305.1|  379|Anopheles gambiae decapentaplegic pr...    24   4.4  
Z22930-7|CAA80512.1|  274|Anopheles gambiae trypsin protein.           24   5.8  
Z22930-4|CAA80516.1|  267|Anopheles gambiae Trypsinogen precurso...    24   5.8  
Z18889-1|CAA79327.1|  274|Anopheles gambiae trypsin protein.           24   5.8  
AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.    23   7.6  

>AY578800-1|AAT07305.1|  379|Anopheles gambiae decapentaplegic
           protein.
          Length = 379

 Score = 24.2 bits (50), Expect = 4.4
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = +2

Query: 383 GHDKITIYIYPLKDYQTENGNSISQFSRE 469
           GHD +     P +   T N N++  F+ E
Sbjct: 46  GHDLVDSVSVPKEGLNTRNANTVRSFTHE 74


>Z22930-7|CAA80512.1|  274|Anopheles gambiae trypsin protein.
          Length = 274

 Score = 23.8 bits (49), Expect = 5.8
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -1

Query: 549 LGTSKHASSGFVV 511
           LGTS+HAS G VV
Sbjct: 102 LGTSRHASGGTVV 114


>Z22930-4|CAA80516.1|  267|Anopheles gambiae Trypsinogen precursor
           of ANTRYP7 protein.
          Length = 267

 Score = 23.8 bits (49), Expect = 5.8
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 549 LGTSKHASSGFVV 511
           LG+S+HASSG VV
Sbjct: 96  LGSSRHASSGTVV 108


>Z18889-1|CAA79327.1|  274|Anopheles gambiae trypsin protein.
          Length = 274

 Score = 23.8 bits (49), Expect = 5.8
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -1

Query: 549 LGTSKHASSGFVV 511
           LGTS+HAS G VV
Sbjct: 102 LGTSRHASGGTVV 114


>AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.
          Length = 1376

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 8/31 (25%), Positives = 16/31 (51%)
 Frame = +2

Query: 581  KSEVSQALQSLSHWNNGENPLLFNMLPGSPP 673
            ++++ +   +L HW     PL  + +P  PP
Sbjct: 1018 ETKLQETKDTLPHWQLQLKPLKLHEIPEEPP 1048


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 731,473
Number of Sequences: 2352
Number of extensions: 15887
Number of successful extensions: 28
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 77339358
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)