BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-2011
(650 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 5.0
>EF592539-1|ABQ95985.1| 630|Tribolium castaneum
beta-N-acetylglucosaminidase FDL protein.
Length = 630
Score = 21.8 bits (44), Expect = 5.0
Identities = 10/31 (32%), Positives = 15/31 (48%)
Frame = -1
Query: 290 RHLKDASPVLDHAICKSYPDSSKLTTSDARP 198
RH+K A PV+ + C S++L P
Sbjct: 68 RHIKGAIPVVSLSTCSMLCGSTQLWPQPTGP 98
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,743
Number of Sequences: 336
Number of extensions: 3262
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16760905
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -