Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-2003
         (580 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    21   3.3  

>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 21.0 bits (42), Expect(2) = 3.3
 Identities = 12/30 (40%), Positives = 12/30 (40%)
 Frame = -1

Query: 283 GASAPTALVGLSLPPSSKNESVMISGDLEP 194
           GAS P  L    LPP    E V      EP
Sbjct: 629 GASEPVPLASWPLPPPYITEPVEGPAKKEP 658



 Score = 21.0 bits (42), Expect(2) = 3.3
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -1

Query: 208 GDLEPSWTPLM 176
           GD  PSW PL+
Sbjct: 692 GDNRPSWRPLI 702


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 496,105
Number of Sequences: 2352
Number of extensions: 9041
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 55086417
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)