Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-1470
         (750 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating...    22   7.1  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    22   7.1  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   7.1  

>S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating
           peptide protein.
          Length = 50

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -2

Query: 605 ICRG*CGKNG 576
           ICR  CGKNG
Sbjct: 41  ICRKICGKNG 50


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 10/37 (27%), Positives = 15/37 (40%)
 Frame = -1

Query: 558 KLEPATTPHEVLGFREYPLADDYKETSVSMWVQEHYG 448
           K+    T  E + FR++  A D     +  W    YG
Sbjct: 799 KIPVRWTAPEAIAFRKFTSASDVWSMGIVCWEVMSYG 835


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 6/10 (60%), Positives = 10/10 (100%)
 Frame = -3

Query: 88   HPDIHNVYAL 59
            +PD+HN+YA+
Sbjct: 1470 YPDLHNLYAV 1479


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,635
Number of Sequences: 438
Number of extensions: 3014
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23510295
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)