SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-1399
         (693 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.        24   5.2  
AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450 CY...    24   5.2  
AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450 pr...    24   5.2  

>DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.
          Length = 494

 Score = 23.8 bits (49), Expect = 5.2
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -3

Query: 517 NDMGHSPYIARPIKRSSRTVMKLSLNNRLYIPFIIKKLKSILFMG 383
           ND   S  +   + R SRT+ +      L+ P  I  + ++LF+G
Sbjct: 84  NDAKISQLVVDFMMRISRTLPQQQSRTELFSPLSIITVANLLFLG 128


>AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450
           CYP6S2 protein.
          Length = 504

 Score = 23.8 bits (49), Expect = 5.2
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 399 DFNFFIIKGIYS 434
           DFN+F+ +G+YS
Sbjct: 97  DFNYFVDRGVYS 108


>AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450
           protein.
          Length = 499

 Score = 23.8 bits (49), Expect = 5.2
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 399 DFNFFIIKGIYS 434
           DFN+F+ +G+YS
Sbjct: 97  DFNYFVDRGVYS 108


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,706
Number of Sequences: 2352
Number of extensions: 12347
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 70250040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -