BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-1399
(693 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 24 5.2
AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 24 5.2
AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 24 5.2
>DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein.
Length = 494
Score = 23.8 bits (49), Expect = 5.2
Identities = 13/45 (28%), Positives = 22/45 (48%)
Frame = -3
Query: 517 NDMGHSPYIARPIKRSSRTVMKLSLNNRLYIPFIIKKLKSILFMG 383
ND S + + R SRT+ + L+ P I + ++LF+G
Sbjct: 84 NDAKISQLVVDFMMRISRTLPQQQSRTELFSPLSIITVANLLFLG 128
>AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450
CYP6S2 protein.
Length = 504
Score = 23.8 bits (49), Expect = 5.2
Identities = 7/12 (58%), Positives = 11/12 (91%)
Frame = +3
Query: 399 DFNFFIIKGIYS 434
DFN+F+ +G+YS
Sbjct: 97 DFNYFVDRGVYS 108
>AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450
protein.
Length = 499
Score = 23.8 bits (49), Expect = 5.2
Identities = 7/12 (58%), Positives = 11/12 (91%)
Frame = +3
Query: 399 DFNFFIIKGIYS 434
DFN+F+ +G+YS
Sbjct: 97 DFNYFVDRGVYS 108
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,706
Number of Sequences: 2352
Number of extensions: 12347
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 70250040
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -