Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-1355
         (710 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    23   2.2  
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    23   2.9  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    21   8.7  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    21   8.7  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    21   8.7  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    21   8.7  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    21   8.7  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    21   8.7  
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    21   8.7  

>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 1/27 (3%)
 Frame = -2

Query: 433 KEAQIFCHNTNMAVKYDN-NNLQMLDK 356
           +E   FC   N  +KYD+   ++ LDK
Sbjct: 332 EEINTFCPKNNKELKYDDIKEMEYLDK 358


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = -2

Query: 421 IFCHNTNMAVKYDNNNLQMLDKDSCQVFLPS 329
           I C N+    +Y  NN++++ KD   +  PS
Sbjct: 330 IGCWNSEHFFEYGGNNIEIIVKDPETLQFPS 360


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 412 HNTNMAVKYDNNN 374
           HN N    Y+NNN
Sbjct: 90  HNNNYKYNYNNNN 102


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 412 HNTNMAVKYDNNN 374
           HN N    Y+NNN
Sbjct: 90  HNNNYKYNYNNNN 102


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 412 HNTNMAVKYDNNN 374
           HN N    Y+NNN
Sbjct: 91  HNNNYKYNYNNNN 103


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 412 HNTNMAVKYDNNN 374
           HN N    Y+NNN
Sbjct: 91  HNNNYKYNYNNNN 103


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 412 HNTNMAVKYDNNN 374
           HN N    Y+NNN
Sbjct: 91  HNNNYKYNYNNNN 103


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 412 HNTNMAVKYDNNN 374
           HN N    Y+NNN
Sbjct: 91  HNNNYKYNYNNNN 103


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = +1

Query: 151 LWRS*KVVIFSSLTYQYVLLYFSQTLVYCSG 243
           +W+   +V+F++    Y + Y S  L+Y +G
Sbjct: 108 VWKP-DIVLFNNADGNYEVRYKSNVLIYPNG 137


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,432
Number of Sequences: 438
Number of extensions: 3479
Number of successful extensions: 11
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21926700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)