Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-1194
         (700 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK097473-1|BAC05067.1|  338|Homo sapiens protein ( Homo sapiens ...    30   9.1  

>AK097473-1|BAC05067.1|  338|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40154 fis, clone TESTI2014339, moderately
           similar to Mus musculus testicular condensing enzyme
           (AMAC1) mRNA. ).
          Length = 338

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%)
 Frame = +2

Query: 419 PXGSKRSVRMGLSTIRTAL--LCMESNGXSWY 508
           P G+  +VR G ST+ +A+  LC+ES G S Y
Sbjct: 126 PAGNAATVRKGSSTVCSAVLTLCLESQGLSGY 157


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,614,756
Number of Sequences: 237096
Number of extensions: 2339105
Number of successful extensions: 4527
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4341
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4527
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)