SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-1104
         (450 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              24   0.67 
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    22   3.6  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   8.2  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   8.2  

>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 24.2 bits (50), Expect = 0.67
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = -3

Query: 409 ISFGSFLHFRKHHXLTSSGKKVLSSPLYATLILGLPPSLTTS 284
           +S   + H R+H   T +     SS    +L + +PPS+  S
Sbjct: 23  VSVAGYKHSRRHRDFTVAESYDASSSNSDSLSMTIPPSIDRS 64


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.8 bits (44), Expect = 3.6
 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%)
 Frame = -3

Query: 376 HHXLTSSGKKVLSSPLYA-TLILGLPP 299
           HH    SG    S+PL A TL  GL P
Sbjct: 511 HHVAPPSGHHASSAPLLAATLAGGLCP 537


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 20.6 bits (41), Expect = 8.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 197 QQHNIRCQTSHR 232
           Q H  RC+T HR
Sbjct: 203 QIHGYRCRTMHR 214


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 20.6 bits (41), Expect = 8.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 197 QQHNIRCQTSHR 232
           Q H  RC+T HR
Sbjct: 203 QIHGYRCRTMHR 214


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 128,949
Number of Sequences: 438
Number of extensions: 2650
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11820384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -