BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1086 (400 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.21 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.21 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.21 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.21 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 25 0.21 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.21 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.21 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 22 1.9 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 22 1.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 3.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 4.5 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 5.9 AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 21 5.9 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 5.9 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 20 7.8 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQRTGYES 271 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQRTGYES 271 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQRTGYES 271 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQRTGYES 271 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQRTGYES 271 M + L QSTV++N +RQR+ T Y++ Sbjct: 160 MKRVHLGQSTVNANGETKRQRTSYTRYQT 188 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQRTGYES 271 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQRTGYES 271 M + L QSTV++N +RQR+ T Y++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTSYTRYQT 232 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 22.2 bits (45), Expect = 1.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 176 SDCMDKSRLRQSTVHSNEIGERQRSQRTGYES 271 SDC Q+ H+NE+ R + + YES Sbjct: 27 SDCDKNQNTEQNYTHNNEMYHRVKEEPI-YES 57 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 22.2 bits (45), Expect = 1.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 176 SDCMDKSRLRQSTVHSNEIGERQRSQRTGYES 271 SDC Q+ H+NE+ R + + YES Sbjct: 27 SDCDKNQNTEQNYTHNNEMYHRVKEEPI-YES 57 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 3.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 185 MDKSRLRQSTVHSNEIGERQRSQ 253 M + L QSTV++N +RQR++ Sbjct: 204 MKRVHLGQSTVNANGETKRQRTR 226 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 4.5 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -3 Query: 338 HRPCTQRRRHPLADPRSDQ 282 H P T PL P+S++ Sbjct: 103 HNPLTPPNSEPLVSPKSEK 121 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 20.6 bits (41), Expect = 5.9 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = -1 Query: 376 HQRRILVLPAGPRTAPAHSGGGTPSRTLARTSS 278 H++ + + PR++PA + +++A T+S Sbjct: 143 HKKEQMNKVSTPRSSPAETASSLSPQSVASTAS 175 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 20.6 bits (41), Expect = 5.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 60 SNYQNARIVVFRRTDVY 10 S+Y+ R + R TDVY Sbjct: 114 SSYEITRFIRSRETDVY 130 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 20.6 bits (41), Expect = 5.9 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = -1 Query: 376 HQRRILVLPAGPRTAPAHSGGGTPSRTLARTSS 278 H++ + + PR++PA + +++A T+S Sbjct: 134 HKKEQMNKVSTPRSSPAETASSLSPQSVASTAS 166 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 20.2 bits (40), Expect = 7.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 377 ASKAHTGPAG 348 A AHTGP G Sbjct: 49 AGNAHTGPTG 58 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,673 Number of Sequences: 336 Number of extensions: 2098 Number of successful extensions: 18 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -