BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1083 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 25 0.85 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 1.5 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 23 2.0 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 6.0 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 24.6 bits (51), Expect = 0.85 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 266 GTIF-GMMLYVLVLNAGQTKPCFNF*AIWGC 177 G +F G+++++L G T P FN ++ C Sbjct: 133 GIVFAGLIVFILFFAQGLTSPIFNLVYVYCC 163 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/23 (43%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +3 Query: 234 ENVEHHAKYRSK--KGQLPFVEL 296 EN++HHA R K KG++ +E+ Sbjct: 380 ENLKHHANLRQKNQKGEVTVLEI 402 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +3 Query: 312 ADSTFIIKDLSEKYNKDLDAGLTSEQRVISH 404 A + + ++ + +YN +LDA L SE+ + S+ Sbjct: 11 ACTNVLSEEYTNQYNDELDAALKSERLMKSY 41 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 684 PTILLWRRTNSPP 722 PTI W T+SPP Sbjct: 319 PTINCWSLTSSPP 331 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,950 Number of Sequences: 336 Number of extensions: 3890 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -