BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1080 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 24 1.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.2 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 22 5.5 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 22 5.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 9.7 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 24.2 bits (50), Expect = 1.0 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +3 Query: 9 KVCCLILRLYPNIVLNFLRL 68 +VC ++++YP +V+N + L Sbjct: 168 EVCTFVVQVYPRLVVNTINL 187 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 439 LTASSRNLTSYVQQVSNKSNSNESTMLV 522 +T+ S TS SNK NS++ ML+ Sbjct: 423 ITSPSNTNTSTSSTNSNKPNSSDLNMLI 450 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 697 LTVIENCFSGHFFLHHRA 644 L++++NC S F L+H A Sbjct: 277 LSIVKNCLSYCFNLYHLA 294 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 697 LTVIENCFSGHFFLHHRA 644 L++++NC S F L+H A Sbjct: 277 LSIVKNCLSYCFNLYHLA 294 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/46 (21%), Positives = 17/46 (36%) Frame = +3 Query: 153 RLWGLDSQKRLRAAKVLIIGLSGLGAEIAKNVILTGVKSVCLLDNE 290 R W +D + + L I + K+ L +C L N+ Sbjct: 302 RAWAMDDESDINGTPPLHISGPAEAGPLTKDAGLLSYPEICTLLND 347 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,211 Number of Sequences: 336 Number of extensions: 3225 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -