BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1076 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58750-5|AAB00645.1| 299|Caenorhabditis elegans Hypothetical pr... 28 6.2 AL032627-14|CAA21549.1| 386|Caenorhabditis elegans Hypothetical... 28 6.2 >U58750-5|AAB00645.1| 299|Caenorhabditis elegans Hypothetical protein F55G1.9 protein. Length = 299 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 257 PTVHAQQTTSWGIASRPKYKISEIGNIPKASISCK 153 P V + +SW + SRP++ IS + +P ++ K Sbjct: 87 PQVFEEVVSSWPVNSRPEFIISVMAGVPLKVLNAK 121 >AL032627-14|CAA21549.1| 386|Caenorhabditis elegans Hypothetical protein Y41C4A.11 protein. Length = 386 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 219 NAPRCGLLSVDCRYIVYRTTQRLSLN-MKHSFAL*AAVWHKDKPWPCATVMSNNRQQDTY 395 N P CGLL T+ R + N + HS + + +H +KPW + + N Q Y Sbjct: 85 NCPNCGLLLA--------TSNRAAPNFVSHSDRVKSVDFHSEKPWILTALHTGNVQIWNY 136 Query: 396 D 398 D Sbjct: 137 D 137 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,089,980 Number of Sequences: 27780 Number of extensions: 317639 Number of successful extensions: 610 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -