BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1075 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 3.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 6.0 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 10 VLPGGGWKEPATQDTSPVSLSRLLRMPNKESRTR 111 +L GW E +TS + R L KE +TR Sbjct: 18 ILISVGWWENFVSETSYLPFIRALGKSKKEFKTR 51 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 10 VLPGGGWKEPATQDTSPVSLSRLLRMPNKESRTR 111 +L GW E +TS + R L KE +TR Sbjct: 251 ILISVGWWENFVSETSYLPFIRALGKSKKEFKTR 284 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 10 VLPGGGWKEPATQDTSPVSLSRLLRMPNKESRTR 111 +L GW E +TS + R L KE +TR Sbjct: 251 ILISVGWWENFVSETSYLPFIRALGKSKKEFKTR 284 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 2 PGASFRVADGRNPR 43 P + FRV DG NP+ Sbjct: 338 PASRFRVEDGFNPQ 351 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 183 KFYSTRHSRFPAEAT*NNLYHGNKPGP-RLLIGHSE*PRQGNW 58 +F +H F + T NN +GN+ G R+ + R W Sbjct: 473 RFTHLQHQPFTYKITVNNQSNGNRKGTCRIFLAPKTDERGNPW 515 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,170 Number of Sequences: 336 Number of extensions: 3692 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -