BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1072 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 3.7 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 4.9 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 6.4 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 6.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.4 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 442 FPQLEMSSHSRRKPCFVLLLYVLFCISLISAPAAKAF 332 +P + RR+P F + +L CI LI++ A F Sbjct: 200 YPDITYEIRLRRRPMFYVFNLILPCI-LINSVALLVF 235 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = +2 Query: 509 YHLCRRKGEIRSTRDQHWHHPRSRRHPASSQIRWQVESNGDRVDRK 646 Y++ R + ++ T+ +W S + S V NGD+ D K Sbjct: 388 YNMVRFRNLVKGTKIDNWWDNGSNQIAFSRGCSGFVAFNGDQYDLK 433 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -1 Query: 616 DLPTYLGRRWVPPAPGMVPMLIS 548 D YL RW P P+L++ Sbjct: 435 DAKKYLPERWTTPTTPHSPLLVA 457 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 348 GADIKEMQNNTYSSNTKQ 401 GA++KE+ NT+ N Q Sbjct: 402 GANVKELIRNTHCVNNNQ 419 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 528 KAKFGQPEINIGTIPGAGGTQRLPRYVGKSKAMEIVLTGN 647 K++FG+ + TQ L + V K+ + + L GN Sbjct: 283 KSQFGENNVQYQGSEDILNTQSLAKAVSKNGVLFVGLVGN 322 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 648 SFLSTRSPLLSTCQRIWEDAGC 583 +FLS S L +W D GC Sbjct: 1506 TFLSPNSTTLVLRLHVWPDNGC 1527 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 648 SFLSTRSPLLSTCQRIWEDAGC 583 +FLS S L +W D GC Sbjct: 1502 TFLSPNSTTLVLRLHVWPDNGC 1523 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,871 Number of Sequences: 438 Number of extensions: 4857 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -