BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1070 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0359 - 28269236-28269541,28270857-28270919,28271439-282714... 33 0.17 04_04_1647 + 35032328-35033803 31 0.51 05_04_0337 - 20372378-20373094,20373320-20373379,20373992-203742... 30 1.2 09_02_0468 - 9608922-9610061 29 2.1 05_05_0036 - 21758409-21758531,21758891-21759206,21759964-217611... 29 2.7 03_01_0564 - 4176177-4178096 29 2.7 07_03_0635 + 20151861-20152249,20152589-20152709,20154914-201549... 28 3.6 04_04_1076 - 30639835-30640898,30641613-30641915,30642008-306420... 28 4.8 04_04_0326 - 24407201-24407374,24407397-24407460,24408266-244086... 28 4.8 01_06_1252 - 35748000-35748173,35748243-35748375,35749771-357498... 28 4.8 02_01_0795 + 5959896-5960061,5960415-5960700,5961664-5961790 27 6.3 01_01_0409 - 3084821-3084988,3085069-3085155,3085270-3085476,308... 27 6.3 12_01_0954 - 9496370-9496643,9497181-9497239,9497574-9498179 27 8.4 11_04_0401 - 17251759-17252208,17252545-17253022,17254235-172542... 27 8.4 04_03_0517 + 16712487-16712570,16713715-16714059,16714149-167143... 27 8.4 >02_05_0359 - 28269236-28269541,28270857-28270919,28271439-28271459, 28271660-28271716,28271789-28271874,28271982-28272039, 28272176-28272311,28272799-28273073,28273564-28273602, 28274052-28274143,28274422-28274454,28275041-28275088, 28275191-28275323 Length = 448 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 286 SGCRQPS--CQWRPSPDPGQVRSCPRCPSLHTG 378 SGCR+ WR SP ++ CP C HTG Sbjct: 403 SGCREAGGPWTWRESPASRAMQKCPACKRTHTG 435 >04_04_1647 + 35032328-35033803 Length = 491 Score = 31.1 bits (67), Expect = 0.51 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 289 GCRQPSCQWRPSPDP-GQVRSCPRCP 363 GCR PSC W SPD R+ CP Sbjct: 150 GCRNPSCLWIHSPDHLSDCRAASSCP 175 >05_04_0337 - 20372378-20373094,20373320-20373379,20373992-20374266, 20374358-20374619 Length = 437 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 301 PSCQWRPSPDPGQVRSCPRCPSLHTGIRSECPSPCSRP 414 P+C+ RPSP + + S H ++ EC + + P Sbjct: 252 PACRHRPSPSSSSTTTAQQHTSFHQLLQGECSAAAAAP 289 >09_02_0468 - 9608922-9610061 Length = 379 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 298 QPSCQWRPSPDPGQVRSCPRCPSLHTGIRSE-CPSPCSRPKKR 423 QP + P P P + R C R + +G +E P P ++PK + Sbjct: 291 QPENRVAPPPPPPRARRCLRALMMESGSDTEAAPKPKTKPKPK 333 >05_05_0036 - 21758409-21758531,21758891-21759206,21759964-21761121, 21761236-21761333 Length = 564 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 202 VRWPWICHDGWPRLFDASI*SSASLLPHVRSE 107 VR+ W+C+D RL D S+ S S ++ E Sbjct: 416 VRFEWVCYDSAKRLLDKSLYSVLSDFAQIQDE 447 >03_01_0564 - 4176177-4178096 Length = 639 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/51 (21%), Positives = 27/51 (52%) Frame = +3 Query: 228 RRSIYPWVLWSYLSTMTWYQRLSATILSMETLAGSWPGSELSPMSITTYGY 380 RR ++PWVL ++ ++ W+ ++ ++++ G G S + +T + Sbjct: 467 RRFLFPWVLGGFVMSIIWFYIIANELVALLVAFGVILGINPSILGLTVLAW 517 >07_03_0635 + 20151861-20152249,20152589-20152709,20154914-20154996, 20155819-20155903,20155987-20156277,20156555-20156645, 20157380-20158280,20158401-20158561,20158759-20158862, 20159040-20159205,20159283-20159378,20159694-20159800, 20160443-20160775,20161393-20161599,20161774-20161857, 20162887-20163020,20163166-20163393,20163541-20163712, 20164301-20164555,20164647-20164919 Length = 1426 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 225 ARRSIYPWVLWSYLSTMTWYQRLSATILSMETLAGSW--PGSELSPMSITTYGYPF 386 +R+ I PW +W Y ++ Y + ++ E LA W P ++ S +S T G F Sbjct: 706 SRKDIKPWWIWGYWTSPMMYSNNALSV--NEFLASRWAIPNND-SSISAPTIGKAF 758 >04_04_1076 - 30639835-30640898,30641613-30641915,30642008-30642068, 30643076-30644380 Length = 910 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 289 GCRQPSCQWRPSPDPGQVRSCPRCPSLHTGIRSECPSPCSRPKKR 423 G PSC+ R + S R S T + E P+P +RP++R Sbjct: 629 GTAAPSCRHRSRRTDKRPSSSGRHGSGRTANKHERPAPATRPRQR 673 >04_04_0326 - 24407201-24407374,24407397-24407460,24408266-24408689, 24408885-24409057,24409178-24409275,24409723-24409853, 24410053-24410174,24411091-24411245,24411976-24412081, 24412328-24412419,24412499-24412620,24413444-24413544, 24413636-24413849,24414173-24414311,24415228-24415584 Length = 823 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -1 Query: 229 LAVWPSRVQVRWPWICHDGWPRLFDASI*SSASLLPHVRSERLDI 95 LAV PS PW CH R+ +A +S P R E + Sbjct: 731 LAVTPSMFTDHLPWRCHYAMQRVLEAQTAASCPDSPESRIELFSV 775 >01_06_1252 - 35748000-35748173,35748243-35748375,35749771-35749847, 35750465-35750509,35750584-35750679,35751125-35751130, 35751259-35751388,35751510-35751706 Length = 285 Score = 27.9 bits (59), Expect = 4.8 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -2 Query: 276 SSLTGNSTEPRDKLISSQSGPQEYRFDGRGYATMAGRGYLTPQSN-QVLLFFRTYA 112 SS G+ + +D I SG G A G GY+ PQSN +L+ +++A Sbjct: 117 SSKAGDGSVKKDT-IGPHSGASSSSAQGMVGAYTQGMGYMQPQSNFHILVVLQSFA 171 >02_01_0795 + 5959896-5960061,5960415-5960700,5961664-5961790 Length = 192 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -1 Query: 178 DGWPRL-FDASI*SSASLLPHVRSERLDIP 92 DG R+ FDAS S +L+P +RS R ++P Sbjct: 131 DGLRRINFDASTNSMVALVPRLRSSRPELP 160 >01_01_0409 - 3084821-3084988,3085069-3085155,3085270-3085476, 3085904-3085985,3086085-3086275,3086410-3086616, 3086709-3086871,3087905-3087960,3088035-3088148, 3088599-3089807 Length = 827 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 253 CGVTCQR*LGTSGCRQPSCQWRPSPDPGQVRSCPRCPSL 369 C + CQR R+P C P P P + CP C +L Sbjct: 577 CNLPCQR------VREPPCS-HPCPLPCHLNDCPPCKAL 608 >12_01_0954 - 9496370-9496643,9497181-9497239,9497574-9498179 Length = 312 Score = 27.1 bits (57), Expect = 8.4 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 319 PSPDPGQVRSCPRCPSLHTGIRSECPSPCSRPKKR*C 429 PSP RS P P T + SPC P+ C Sbjct: 8 PSPSLPPSRSSPHVPPCSTLLHQAPTSPCQAPRPTSC 44 >11_04_0401 - 17251759-17252208,17252545-17253022,17254235-17254290, 17254489-17255019 Length = 504 Score = 27.1 bits (57), Expect = 8.4 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = -1 Query: 352 DSSEPGQDPARVSIDKMVADNRWYQVIVD 266 D+ G + +V +D+ +AD+RW ++ + Sbjct: 254 DNRREGWNNVKVRLDRAIADDRWRDIVTN 282 >04_03_0517 + 16712487-16712570,16713715-16714059,16714149-16714301, 16714889-16714972,16715426-16715479,16715552-16715647, 16716163-16716258,16716941-16717086,16717650-16717799, 16717889-16718018,16718128-16718787,16718881-16718979, 16719058-16719210,16719323-16720054,16720338-16720640 Length = 1094 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/43 (25%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 76 DRRLEKVYQAVRSVRAEEEKHLIRLRRQITSASHRGIST-AIE 201 ++ EK YQ + +++ ++ ++ L ++++ +SH +T AIE Sbjct: 1001 EQETEKAYQEIDNLKKNYDQEIVALNQRLSESSHHQETTLAIE 1043 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,245,703 Number of Sequences: 37544 Number of extensions: 339123 Number of successful extensions: 1166 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -