BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1063 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57061| Best HMM Match : Sec62 (HMM E-Value=0.27) 40 0.001 SB_32268| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 32 0.51 SB_43015| Best HMM Match : Catalase-rel (HMM E-Value=3.4) 31 0.68 SB_27538| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_23784| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_30357| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7977| Best HMM Match : MOZ_SAS (HMM E-Value=3.4e-21) 31 1.2 SB_53370| Best HMM Match : GnRH (HMM E-Value=7.1) 31 1.2 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 31 1.2 SB_44733| Best HMM Match : Sof1 (HMM E-Value=3.4) 30 1.6 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 30 2.1 SB_57040| Best HMM Match : Glyco_hydro_65C (HMM E-Value=1.9) 30 2.1 SB_31936| Best HMM Match : Glyco_hydro_65C (HMM E-Value=1.1) 30 2.1 SB_28134| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_20300| Best HMM Match : hATC (HMM E-Value=0.036) 30 2.1 SB_11341| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_6514| Best HMM Match : hATC (HMM E-Value=0.024) 30 2.1 SB_57822| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_51068| Best HMM Match : hATC (HMM E-Value=0.024) 30 2.1 SB_48175| Best HMM Match : hATC (HMM E-Value=0.024) 30 2.1 SB_47551| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40436| Best HMM Match : EGF_CA (HMM E-Value=0.0038) 30 2.1 SB_32909| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_11985| Best HMM Match : hATC (HMM E-Value=0.022) 30 2.1 SB_50659| Best HMM Match : PCMT (HMM E-Value=1.8) 29 2.7 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 29 3.6 SB_43487| Best HMM Match : K-box (HMM E-Value=0.79) 29 3.6 SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) 29 3.6 SB_14622| Best HMM Match : DUF1441 (HMM E-Value=1.6) 29 3.6 SB_55137| Best HMM Match : hATC (HMM E-Value=0.059) 29 4.8 SB_41489| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 29 4.8 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 29 4.8 SB_41427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_40860| Best HMM Match : MAAL_N (HMM E-Value=0.6) 29 4.8 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 4.8 SB_59689| Best HMM Match : Pkinase (HMM E-Value=0.007) 28 6.3 SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 28 6.3 SB_54| Best HMM Match : Actin (HMM E-Value=0) 28 6.3 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 28 6.3 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 28 6.3 SB_17953| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 28 6.3 SB_53470| Best HMM Match : E-MAP-115 (HMM E-Value=7.6) 28 8.4 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 28 8.4 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_57061| Best HMM Match : Sec62 (HMM E-Value=0.27) Length = 243 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/48 (41%), Positives = 31/48 (64%) Frame = +2 Query: 32 ELVLEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMV 175 E EEI+ R Y+KEK RL+ I E+ +Q+K +LE D++Y+ +V Sbjct: 193 EKAKEEIEKARASYDKEKDRLEKLIKEMTDELQEK-ELENDRQYQTIV 239 >SB_32268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.39 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +2 Query: 65 DKYEKEKTRLQTFIDEVDSSIQKKRDLEY-DQKYEEMVLKLIEFAKKDFIYKGFDPLIER 241 ++YE EK + + D+ + +K D EY D+KYEE K E+ KD+ K + + Sbjct: 2 EEYEDEKYGDEEYEDK-EYEYEKYGDEEYEDKKYEEEKYKEEEYEDKDWNMKSKNMKTKN 60 Query: 242 LKALSNVHVEGRKRK 286 +K N + KRK Sbjct: 61 IKTKKNT-TKNMKRK 74 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 31.9 bits (69), Expect = 0.51 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +2 Query: 32 ELVLEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMV 175 E EEI+ Y+KEK RL+ ++ +Q+K +LE D++Y+++V Sbjct: 761 EKAKEEIEKAWALYDKEKDRLEKINWQMTDELQEK-ELENDRQYQKIV 807 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/44 (34%), Positives = 28/44 (63%) Frame = +2 Query: 44 EEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMV 175 EEI+ Y+KEK RL+ ++ +Q+K +LE D++Y+ ++ Sbjct: 625 EEIEKAWTLYDKEKDRLEKINWQMTDELQEK-ELENDRQYQTII 667 >SB_43015| Best HMM Match : Catalase-rel (HMM E-Value=3.4) Length = 285 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG ID + Sbjct: 61 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIDGF 95 >SB_27538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG ID + Sbjct: 61 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIDGF 95 >SB_23784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTI 658 DLT P+ Y N WWS +E + K QFG I Sbjct: 182 DLTGQRPRSYSENRWWSKWE-VYKQMLLQFGDI 213 >SB_30357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +1 Query: 31 RARSRGDKDGKRQIREREDTPADLHR*SGQLDTEETRSRVRSK 159 RAR +K K+ +E+ED D HR +G + E SRV+ K Sbjct: 65 RARKSTEKGCKKAEKEKEDREKDSHRETG-WEQENKESRVKEK 106 >SB_7977| Best HMM Match : MOZ_SAS (HMM E-Value=3.4e-21) Length = 570 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 29 HELVLEEIKMERDKYEKEKTRLQTFIDEVDSSI 127 H+ +LE ++KYEKEK RL F +E ++ I Sbjct: 427 HQDLLERELKNQEKYEKEKARLIKFTEEKNNEI 459 >SB_53370| Best HMM Match : GnRH (HMM E-Value=7.1) Length = 244 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/89 (21%), Positives = 35/89 (39%) Frame = +1 Query: 295 YRRHPERIHADRHHKIHIRGIVSLREVL*GNHKEIHAXXXXXXXXXXXXXXXLPQERGPQ 474 +R+H + + H H + V+ E G H++ H +E G Sbjct: 148 HRQH--HVTYEEEHGTHRQQHVTYEEEH-GTHRQHHVTYEEEHGTHRQQHVTYEEEHGTH 204 Query: 475 REHNEQLDQKRQDQRRHSEAESQKHGDIR 561 R+H+ ++K R+H ++HG R Sbjct: 205 RQHHVTYEEKHGTHRQHHVTYEEEHGTHR 233 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +2 Query: 41 LEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRD 142 +EEIK++ E+EK LQT + ++ I+K+++ Sbjct: 494 MEEIKLKMKAIEQEKLSLQTTVKSLEDEIKKEKE 527 >SB_44733| Best HMM Match : Sof1 (HMM E-Value=3.4) Length = 287 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/75 (29%), Positives = 35/75 (46%) Frame = +2 Query: 59 ERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMVLKLIEFAKKDFIYKGFDPLIE 238 E+D+ + KT++ TFI + SI ++ + D++ E K E +K K FD E Sbjct: 213 EKDQQTQLKTQIDTFILILQESILRRIIEDADKEEERKRKKRKEGERKSQFVKSFDTKEE 272 Query: 239 RLKALSNVHVEGRKR 283 K L +KR Sbjct: 273 LRKKLEERESVEKKR 287 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 41 LEEIKMERDKYEKEKTRLQTFIDEV-DSSIQKKRDLE 148 L+ K +RDK+E EKT L + EV D I K++ E Sbjct: 1521 LDGAKRDRDKFEMEKTSLDNRLREVEDDLIDKQKQKE 1557 >SB_57040| Best HMM Match : Glyco_hydro_65C (HMM E-Value=1.9) Length = 269 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 140 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 174 >SB_31936| Best HMM Match : Glyco_hydro_65C (HMM E-Value=1.1) Length = 291 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 67 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 101 >SB_28134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 140 DLTGQRPRSYSETRWWSKWE-VYKKMLLQFGDIEGF 174 >SB_20300| Best HMM Match : hATC (HMM E-Value=0.036) Length = 423 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 134 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 168 >SB_11341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 134 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 168 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 674 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 708 >SB_6514| Best HMM Match : hATC (HMM E-Value=0.024) Length = 620 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 331 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 365 >SB_57822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 140 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 174 >SB_51068| Best HMM Match : hATC (HMM E-Value=0.024) Length = 281 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 22 DLTGQRPRSYSKTRWWSKWE-VYKQMLLQFGDIEGF 56 >SB_48175| Best HMM Match : hATC (HMM E-Value=0.024) Length = 620 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 331 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 365 >SB_47551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 371 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 405 >SB_40436| Best HMM Match : EGF_CA (HMM E-Value=0.0038) Length = 676 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 387 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 421 >SB_32909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 307 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 341 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +2 Query: 59 ERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMVLKLIEFAKKDFIYKGFDPLIE 238 E D + R +++ + +I +KRD E +EE + I+ A+ D + FD +E Sbjct: 2183 ELDSQDLVSGRTANIVEKTERTIHEKRDCEDGVDWEEDRIISIQRARSDSLNTEFDDTVE 2242 >SB_11985| Best HMM Match : hATC (HMM E-Value=0.022) Length = 865 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 384 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDIEGF 418 >SB_50659| Best HMM Match : PCMT (HMM E-Value=1.8) Length = 398 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTIDNW 667 DLT P+ Y WWS +E + K QFG I+ + Sbjct: 265 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGYIEGF 299 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 29.1 bits (62), Expect = 3.6 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 4/97 (4%) Frame = +2 Query: 41 LEEIKMERDKYEKEKTRLQTFIDEVDSSIQKK----RDLEYDQKYEEMVLKLIEFAKKDF 208 ++ +K DK EKEK L+ IDE+ + K D+E K + I F + Sbjct: 1391 IDNLKAAIDKTEKEKEDLKADIDELKAENIKLNKLINDMEAGIKRTQTESDRIAFENESN 1450 Query: 209 IYKGFDPLIERLKALSNVHVEGRKRKVVNIEDILNVY 319 + K + L ++ AL + + K K+ + ++LN + Sbjct: 1451 V-KKIESLENQITALKK-NEQSNKEKINELRNMLNTH 1485 >SB_43487| Best HMM Match : K-box (HMM E-Value=0.79) Length = 243 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 5/76 (6%) Frame = +2 Query: 29 HELVLEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYD---QKYEEMVLKLIEF-- 193 H L LE + + +LQ IDE++ +++K++ Y K +E++ +L E Sbjct: 124 HSLRLEREALSLEYDHANFDKLQKLIDELEDVVKRKKEAIYGMELDKLQELIDQLEEAVK 183 Query: 194 AKKDFIYKGFDPLIER 241 K+D +Y G++ + +R Sbjct: 184 TKEDKVY-GYEQVSQR 198 >SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) Length = 982 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +1 Query: 457 QERGPQREHNEQLDQKRQDQRRHSEAESQKHGDIRPDQDVPSRVLREQLVVYL*RHP-QK 633 Q+R ++ +Q Q R+ ++ + E Q H +PD+D + ++ P Q+ Sbjct: 869 QDREQEKPDKDQEKQDREQEKPDKDQEKQDHEQEKPDKDQEKQDREQEKTDKEREQPYQE 928 Query: 634 QGKP 645 Q KP Sbjct: 929 QDKP 932 >SB_14622| Best HMM Match : DUF1441 (HMM E-Value=1.6) Length = 426 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 420 LPWYSCVYFLMISL*YFSKRHNSSYVY 340 LPWY+ FL S+ F + HN ++ Y Sbjct: 31 LPWYNAYRFLSQSIDQFQRVHNVNFAY 57 >SB_55137| Best HMM Match : hATC (HMM E-Value=0.059) Length = 619 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTI 658 DLT P+ Y WWS +E + K QFG I Sbjct: 330 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDI 361 >SB_41489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +2 Query: 17 RFSGHELVLEEIKMERDKYEKEKTRLQTFIDEVDS---SIQKKRDLEYDQKYEEMVL 178 RF G L E+ ER K EKE+ L D+++S ++QK+R + Q +E+ L Sbjct: 185 RFEGTNRSLLEMLDERAKMEKERLALSARNDKLESLCRAMQKERLILNKQALDELKL 241 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 28.7 bits (61), Expect = 4.8 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 5/92 (5%) Frame = +2 Query: 41 LEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQK-----YEEMVLKLIEFAKKD 205 +E++ K+++ KTR DE+D +K+ DL Q+ + + L E +K+ Sbjct: 188 VEDMAALAKKHKQLKTRNDDLQDELDQVTRKRDDLISTQRSLTRDVDHLTTSLEEVQRKN 247 Query: 206 FIYKGFDPLIERLKALSNVHVEGRKRKVVNIE 301 Y D + LK + N+ R+ K V I+ Sbjct: 248 RKYA--DEVDRLLKKIQNIEDSFREEKAVLIK 277 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTI 658 DLT P+ Y WWS +E + K QFG I Sbjct: 1544 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDI 1575 >SB_41427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = -3 Query: 383 PYNTSLRDTIPRMCIL*CRSACIRSGCLLY*RPSVCVPRHGRSTKLSVARLKDQSPCR*S 204 PY S+RD P C L C+ + L Y C +G+ KL + SPC+ Sbjct: 335 PYPISVRDITPNACRLACKHSKHAYAGLQYGYLCRCGDTYGKYAKLD--DFQCSSPCKGD 392 Query: 203 P 201 P Sbjct: 393 P 393 >SB_40860| Best HMM Match : MAAL_N (HMM E-Value=0.6) Length = 538 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 560 DLTRTYPQEYYANNWWSIYEDILKNRENQFGTI 658 DLT P+ Y WWS +E + K QFG I Sbjct: 330 DLTGQRPRSYSETRWWSKWE-VYKQMLLQFGDI 361 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +2 Query: 2 RRXLQRFSGH-ELVLEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDL 145 +R LQ S E V +++ ER+ + KEK Q D++++ I+K+R++ Sbjct: 79 QRMLQEKSDWLEQVERQMEQEREVFAKEKAEFQ---DQIENQIEKEREI 124 >SB_59689| Best HMM Match : Pkinase (HMM E-Value=0.007) Length = 881 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/42 (23%), Positives = 27/42 (64%) Frame = +1 Query: 451 LPQERGPQREHNEQLDQKRQDQRRHSEAESQKHGDIRPDQDV 576 L +E+ PQ+ +E+ QK +++++H E +K ++ ++++ Sbjct: 623 LKEEKPPQKITSEEQKQKERNRQKHREEMERKREKLQKEREL 664 >SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 28.3 bits (60), Expect = 6.3 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Frame = +1 Query: 454 PQERGPQREHNEQLDQKRQDQRRHSEAESQKHGD--IRPDQDVPSRVLREQLVVYL*RHP 627 P +GPQ + ++ + Q H +S GD RP Q+ P+ +Q V L +P Sbjct: 378 PYAQGPQPQQSQHMAQNVSYPATHQHYQSSGQGDQGHRPQQNPPN----DQQHVGLGAYP 433 Query: 628 QKQGKPIRDY 657 Q P + Y Sbjct: 434 PIQAHPTQPY 443 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 28.3 bits (60), Expect = 6.3 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +2 Query: 44 EEIK--MERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMVLKLIEFAKKDFIYK 217 +EIK +E+++ E+EK R++ ++S +KKR LE QK E I +K F+ + Sbjct: 102 QEIKNEVEKERQEEEKRRMEIEKQRMES--EKKRILESKQKRIEESKDTIHDNEK-FLEE 158 Query: 218 GFDPLIERLK 247 L+E++K Sbjct: 159 QRKRLVEKVK 168 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 460 ERGPQREHNEQLDQKRQDQRRHSEAESQK 546 E+ QRE N+QL Q+++++R+ E QK Sbjct: 1119 EKKFQREENQQLRQQKEEERQTEWLEQQK 1147 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 44 EEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYD-QKYEEMVLKLIEFAKK 202 E ++ + +K +KEK RL+ E ++KK E + +K EE + IE KK Sbjct: 353 ERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKK 406 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +1 Query: 457 QERGPQREHNEQLDQKRQDQRRHSEAESQKHGDIRPDQDVPSRV 588 Q+RG QR+H Q Q Q QR+ S + QK +P Q + +V Sbjct: 1795 QQRGRQRQHQGQ--QLHQGQRQQSTQQQQKQ---QPRQSLQKKV 1833 >SB_17953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +2 Query: 29 HELVLEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMV 175 HE + E ++++D+YE +K + +++ D I R+ D +V Sbjct: 6 HEAIKETGRIKQDEYEGQKEAFKPLVEKEDKEISDLREKYIDSMNRPIV 54 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +2 Query: 41 LEEIKMERDKYEKEK----TRLQTFIDEVDSSIQKKRDLEYDQK 160 L+ K +RDKY+ EK RLQ++ DE++ ++K E + K Sbjct: 1598 LDGAKRDRDKYQLEKEEAEKRLQSYEDELNEKQKQKEKAEDNLK 1641 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 28.3 bits (60), Expect = 6.3 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +2 Query: 44 EEIK--MERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMVLKLIEFAKKDFIYK 217 +EIK +E+++ E+EK R++ ++S +KKR LE QK E I +K F+ + Sbjct: 220 QEIKNEVEKERQEEEKRRMEIEKQRMES--EKKRILESKQKRIEESKDTIHDNEK-FLEE 276 Query: 218 GFDPLIERLK 247 L+E++K Sbjct: 277 QRKRLVEKVK 286 >SB_53470| Best HMM Match : E-MAP-115 (HMM E-Value=7.6) Length = 192 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/41 (31%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 457 QERGPQREHNEQLDQKR--QDQRRHSEAESQKHGDIRPDQD 573 ++R P +E ++ D++R +D+ RH E + +H D R D++ Sbjct: 15 EKRVPGKEEEDRHDEERNDEDEDRHDEERNNEHED-RHDEE 54 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 27.9 bits (59), Expect = 8.4 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 3/94 (3%) Frame = +2 Query: 2 RRXLQRFSGHELVLEEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEM--- 172 ++ ++ +EEI+ K EK + RLQ + + +I ++ +E D E Sbjct: 1320 KKLVREMEALNTTVEEIQGSNAKLEKTRKRLQNEMMAEEKAISERYAMERDNAEREARQN 1379 Query: 173 VLKLIEFAKKDFIYKGFDPLIERLKALSNVHVEG 274 K+I + + Y+ ERL+ L+ +EG Sbjct: 1380 ETKVISLSHELEEYQDKLAESERLRKLAQTELEG 1413 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +2 Query: 47 EIKMERDKYEKEKTRLQTFIDEVDSSIQKKRD--LEYDQKYEEMVLKLIEFAKK 202 E K++ + EKEK + Q D+ +QK++D +E +++ +E V K +E K+ Sbjct: 526 EEKLKLAEEEKEKKKQQIQEDKEKKKLQKEKDRAVEREKREKERVQKKLEKDKE 579 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +2 Query: 32 ELVLEEIKMERDKYEKEKTRLQTFIDEVDSSI--QKKRDLEYDQKYEEMVLKLI 187 E+ LEE+K + E+E +L+ I+ D I Q+KR +Y ++ E++ KL+ Sbjct: 600 EIELEELKDNIEDLERENKKLKGEIECNDEMIQYQEKRINQYAEEIEKLEDKLM 653 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Frame = +2 Query: 23 SGHELVLEEIKMERDK-YEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYEEMVLKLIEFAK 199 +G+E + EIK E+D Y++ K +++ + KR +E+ + + K +E AK Sbjct: 1190 TGYENTISEIKKEKDMLYDEVKHLKDIRAQQLEEIEELKRQIEHMRDVQNNYQKELE-AK 1248 Query: 200 KDFIYKGFDPLIERLKALSNV 262 D ++ D E ++ L ++ Sbjct: 1249 DDSLHYLQDSKKEMMRELEDL 1269 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 27.9 bits (59), Expect = 8.4 Identities = 21/93 (22%), Positives = 44/93 (47%), Gaps = 5/93 (5%) Frame = +2 Query: 44 EEIKMERDKYEKEKTRLQTFIDEVDSSIQKKRDLEYDQKYE-----EMVLKLIEFAKKDF 208 + +K + D + RLQ +DE++ + K + L +++ + E + K + + F Sbjct: 1397 DRLKNQNDFLLSQGKRLQARVDELEQELGKVKSLLVEKQLKKEIVVESISKTSDINLESF 1456 Query: 209 IYKGFDPLIERLKALSNVHVEGRKRKVVNIEDI 307 PL E L NV + ++++NI+D+ Sbjct: 1457 PNNDIQPLNESLMMQQNVK---QMQELLNIKDM 1486 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,294,550 Number of Sequences: 59808 Number of extensions: 343218 Number of successful extensions: 1601 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 1323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1590 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -