BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1061 (528 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 29 2.3 06_03_0924 - 25976629-25976979,25977471-25978424,25978512-259785... 29 2.3 06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910,152... 29 2.3 02_02_0537 + 11308195-11309667 29 2.3 01_05_0645 - 23899579-23904483 29 2.3 04_04_0933 + 29495656-29496972,29497244-29497819,29499414-294996... 29 3.1 01_01_0060 + 477667-477816,479312-479722 29 3.1 02_04_0149 + 20201674-20201891,20202009-20202111,20202658-202027... 28 5.3 08_01_0125 + 1001397-1001865,1002743-1002810,1003359-1003490,100... 27 7.1 05_06_0027 - 25029725-25030017,25030097-25030211,25030347-250305... 27 7.1 03_06_0127 - 31872840-31872912,31873021-31873115,31873199-318732... 27 7.1 12_01_1068 - 11052769-11052943,11053103-11053182,11053304-110534... 27 9.3 08_02_0210 + 14324539-14324609,14324735-14325740,14325838-143273... 27 9.3 01_06_1050 + 34125087-34126001,34126082-34126639 27 9.3 01_01_0595 - 4430738-4430785,4430904-4432679 27 9.3 >10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 Length = 1357 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +1 Query: 217 FSRSINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPVSFSPDLLSGSRFRSGGRFC 393 F +IN + H PSSS T T + H H P SF P + ++ ++ R C Sbjct: 983 FHININNLLQSFPHNKPSSSTKRHDTIPQTPYILHNH-PNSFLPQYILRTQPKAPCRSC 1040 >06_03_0924 - 25976629-25976979,25977471-25978424,25978512-25978565, 25979135-25979254,25979357-25979532,25979624-25980107, 25980541-25980744,25981671-25981877,25982179-25982271, 25982433-25982621,25983364-25983423,25983591-25983927, 25984195-25984432,25984614-25984816,25985549-25986554, 25987125-25987290,25987715-25987824,25987944-25988195, 25988360-25988402,25988488-25988550,25989512-25989624, 25990787-25990838 Length = 1824 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/61 (21%), Positives = 29/61 (47%) Frame = -2 Query: 197 VTSTVYHSVYRIGYVVSSDHKKRVLMSCRLLEMAP*CRL*ILTDRVELRGIVEIHVPQKP 18 +++ ++S ++ S KKR M +L+ P +L + ++ ++ I H P+ Sbjct: 555 ISNDKFYSNRKMSQQARSHAKKRATMGLKLVHSVPAQKLQTMKPKLSIKEIANFHRPKAK 614 Query: 17 W 15 W Sbjct: 615 W 615 >06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910, 1522246-1522358,1522432-1522642,1523087-1523133, 1523211-1523369,1523521-1523624,1524300-1524634 Length = 416 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 287 SDGFDEDGDRCLWCLKAP 234 SDGFDE D C CL+ P Sbjct: 282 SDGFDEGADACAVCLERP 299 >02_02_0537 + 11308195-11309667 Length = 490 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +1 Query: 217 FSRSINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPVSFSPDLLSGSRFRSGGRFC 393 F +IN + H PSSS T T + H H P SF P + ++ ++ R C Sbjct: 141 FHININNLLQSFPHNKPSSSTKRHDTIPQTPYILHNH-PNSFLPQYILRTQPKAPCRSC 198 >01_05_0645 - 23899579-23904483 Length = 1634 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +1 Query: 217 FSRSINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPVSFSPDLLSGSRFRSGGRFC 393 F +IN + H PSSS T T + H H P SF P + ++ ++ R C Sbjct: 1260 FHININNLLQSFPHNKPSSSTKRHDTIPQTPYILHNH-PNSFLPQYILRTQPKAPCRSC 1317 >04_04_0933 + 29495656-29496972,29497244-29497819,29499414-29499650, 29499736-29500048,29500191-29500300 Length = 850 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +1 Query: 205 PHYGFSRSINGAFRHHKHRSPSSSNPSLATKGSTSELTHRH--SPVSFSPDLLSGSRFR 375 P R + A R P SNP A + ++ L HR P D+L+ SR R Sbjct: 4 PPSSLLRDLLAADGFRNRRKPPDSNPPAAPRTTSMPLQHRRPSRPARSQSDVLTRSRLR 62 >01_01_0060 + 477667-477816,479312-479722 Length = 186 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 244 RHHKHRS-PSSSNPSLATKGSTSELTHRHSPVSFSPDL 354 RHH H S SSS+P +TK + ++L H ++ L Sbjct: 32 RHHHHYSTSSSSSPPSSTKEAVTQLDHLEQAAAYIKQL 69 >02_04_0149 + 20201674-20201891,20202009-20202111,20202658-20202765, 20202882-20202991,20203170-20203277,20203667-20203733, 20204044-20204078,20204456-20204501,20204692-20204844 Length = 315 Score = 27.9 bits (59), Expect = 5.3 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = -2 Query: 278 FDEDGDRCLWCLKAPLMDRENP**GALVTSTVYHSVYRIGYVVSSDHKKRVLMSC 114 F+ DG+ CL C K ++ NP GALV H SSD+ K L+SC Sbjct: 29 FNRDGNYCLSCGKDRIIRLWNPHTGALVKPYKSHGREVRDVNSSSDNAK--LVSC 81 >08_01_0125 + 1001397-1001865,1002743-1002810,1003359-1003490, 1003649-1003810,1003973-1004260 Length = 372 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +1 Query: 226 SINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPVSFSPDLLSGSRFRSGG 384 S NG + R P SS +L +G L+ S F P SG+R RSGG Sbjct: 200 SANGVISNVTLRQPDSSGGTLTYEGRFELLSLSGS---FMPTENSGTRSRSGG 249 >05_06_0027 - 25029725-25030017,25030097-25030211,25030347-25030504, 25030582-25030682,25030846-25030994,25031089-25031239, 25031329-25031482,25032249-25032321,25032446-25032676 Length = 474 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +1 Query: 262 SPSSSNPSLATKGSTSELTHRHSPVSFSPDLLSGSRFRSG 381 +P+ PS + ++ H H F P L+ FR+G Sbjct: 95 TPTKGKPSSGKTTTCTKYAHYHQLKGFKPSLVCADTFRAG 134 >03_06_0127 - 31872840-31872912,31873021-31873115,31873199-31873288, 31873364-31873399,31874039-31874122,31874223-31874312, 31874426-31874740,31875674-31875883,31875965-31876036 Length = 354 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 313 LTHRHSPVSFSPDLLS--GSRFRSGG-RFCEARLLLGSALATLRF 438 L+ H P SF+PD +S R ++GG EA+ GSA ++ F Sbjct: 227 LSQVHPPCSFTPDEISYLTKRIQNGGTEVVEAKAGAGSATLSMAF 271 >12_01_1068 - 11052769-11052943,11053103-11053182,11053304-11053401, 11053487-11053627,11053701-11053841,11053933-11054017, 11055296-11055826,11055926-11055940 Length = 421 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 187 VDVTKAPHYGFSRSINGAFRHHKHRSPSSSNPSLATKGST 306 +D TK+ + RS NG HH SP+ ++ G T Sbjct: 201 IDFTKSNEWTGKRSFNGMSLHHIGDSPNPYEQAITIIGQT 240 >08_02_0210 + 14324539-14324609,14324735-14325740,14325838-14327390, 14327473-14327601,14328345-14328510 Length = 974 Score = 27.1 bits (57), Expect = 9.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 140 GRWKLHTRSCRPNGKQSTSPK 202 G+W++ +SC G ++TSPK Sbjct: 848 GKWQVQCKSCLGMGHRATSPK 868 >01_06_1050 + 34125087-34126001,34126082-34126639 Length = 490 Score = 27.1 bits (57), Expect = 9.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 320 WVNSLVEPFVASDGFDEDGDRCLWCLKA 237 +V S++E F+ F+ DGD+ LW KA Sbjct: 113 YVVSVMEDFLGHGIFNSDGDQWLWQRKA 140 >01_01_0595 - 4430738-4430785,4430904-4432679 Length = 607 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -1 Query: 141 PQEEGSHVVPPSRNGAMMPTVDTY*QSRAPGHRGDPRASETMVLP 7 P ++ + +PP R+ A+ P++ +RAP D A ++ LP Sbjct: 197 PFKDLVNTLPPPRDAAVSPSIPAKKSARAPPSPKDTAAPVSVCLP 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,855,950 Number of Sequences: 37544 Number of extensions: 326213 Number of successful extensions: 945 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1166441080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -