BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1059 (600 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 54 1e-07 At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein si... 52 4e-07 At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 50 9e-07 At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 49 2e-06 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 49 3e-06 At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein si... 44 1e-04 At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein si... 43 1e-04 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 42 3e-04 At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein si... 38 0.004 At1g61810.1 68414.m06972 glycosyl hydrolase family 1 protein con... 31 0.77 At4g15960.1 68417.m02423 epoxide hydrolase, putative similar to ... 30 1.0 At5g40470.1 68418.m04908 expressed protein 30 1.3 At2g19640.2 68415.m02295 SET domain-containing protein contains ... 29 1.8 At2g19640.1 68415.m02294 SET domain-containing protein contains ... 29 1.8 At5g18820.1 68418.m02236 chaperonin, putative similar to SWISS-P... 29 2.4 At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containi... 29 2.4 At2g33210.1 68415.m04069 chaperonin, putative similar to SWISS-P... 29 2.4 At3g09080.1 68416.m01067 transducin family protein / WD-40 repea... 29 3.1 At3g23990.1 68416.m03013 chaperonin (CPN60) (HSP60) identical to... 28 5.4 At5g54630.1 68418.m06802 zinc finger protein-related contains Pr... 27 7.2 At4g17020.2 68417.m02567 transcription factor-related contains w... 27 7.2 At4g17020.1 68417.m02568 transcription factor-related contains w... 27 7.2 At4g03450.1 68417.m00472 ankyrin repeat family protein contains ... 27 7.2 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 27 9.5 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 53.6 bits (123), Expect = 1e-07 Identities = 31/111 (27%), Positives = 59/111 (53%), Gaps = 1/111 (0%) Frame = +3 Query: 177 DLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAIT-SLKAKYPGLTVLL 353 D+D +L THL +A ++ ++Y++ N + A T +++ + P + LL Sbjct: 22 DIDSSLF--THLFCTFADLEAESYEITIATWN------QAPFHAFTETVQQRNPHVKTLL 73 Query: 354 SVGGDADTEEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAWQFPR 506 S+GG + + + + + +R +FI S + +A YGF G+DL W++PR Sbjct: 74 SIGGG--NADKDAFASMASNPDSRASFIQSTITVARSYGFHGLDLDWEYPR 122 >At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 363 Score = 51.6 bits (118), Expect = 4e-07 Identities = 30/101 (29%), Positives = 51/101 (50%) Frame = +3 Query: 204 THLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTVLLSVGGDADTEE 383 THL +A + P T +V + ++ N+ I +K K P + LLS+GG + Sbjct: 39 THLFCAFADLDPQTNSVVVSGAH---EQEFSNFTKI--VKKKNPHVQTLLSIGGR--NAD 91 Query: 384 PEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAWQFPR 506 + + + +R +FI S + A Y FDG+DL W++P+ Sbjct: 92 KSAFASMASNPTSRKSFIWSAISSARYYRFDGLDLVWKYPK 132 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 50.4 bits (115), Expect = 9e-07 Identities = 32/118 (27%), Positives = 58/118 (49%) Frame = +3 Query: 150 ESQARMLPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAK 329 E+Q + + P+ F THL +A + +++K+ + I T ++K + Sbjct: 24 ETQDPITSAETIPSALF-THLFCAFADLDANSHKVFVSQAHEFIFSTFTE-----TVKIR 77 Query: 330 YPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAWQFP 503 P + LLS+GG + + + Q+R FI+S + +A GF G+DLAW++P Sbjct: 78 NPQVKTLLSIGGK--NANNSAFASMASNHQSRKTFIDSWIFIARSNGFHGLDLAWEYP 133 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 49.2 bits (112), Expect = 2e-06 Identities = 30/109 (27%), Positives = 54/109 (49%) Frame = +3 Query: 177 DLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTVLLS 356 D+D +L THL +A + T ++ + N T +++ + P + LLS Sbjct: 43 DIDSSLF--THLFCAFADLNSQTNQVTVSSANQPKFSTFTQ-----TVQRRNPSVKTLLS 95 Query: 357 VGGDADTEEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAWQFP 503 +GG + Y + + +R +FI+S + +A YGF G+DL W++P Sbjct: 96 IGGGI--ADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYP 142 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 48.8 bits (111), Expect = 3e-06 Identities = 30/105 (28%), Positives = 51/105 (48%) Frame = +3 Query: 195 SFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTVLLSVGGDAD 374 S THL +A I TY+++ + N T +++ + P + LLS+GGD Sbjct: 45 SLFTHLFCAFADINTLTYQVIVSSRNKPKFSTFTQ-----TVRRRNPTVKTLLSIGGDFT 99 Query: 375 TEEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAWQFPRV 509 + + + +R FI+S + LA GF G+DL W++P + Sbjct: 100 YNFA--FASMASNPTSRKLFISSSIKLARSCGFHGLDLNWKYPSI 142 >At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 365 Score = 43.6 bits (98), Expect = 1e-04 Identities = 33/125 (26%), Positives = 60/125 (48%) Frame = +3 Query: 129 DSRSYVRESQARMLPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRA 308 D +S E ++ P + F THL +A + T+++ N ++ Sbjct: 22 DGKSQSPECLSQGTPSSFIDSTLF-THLFCAFADVDSSTHEVTISAAN-----SYQFSSF 75 Query: 309 ITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDL 488 ++K K + LLS+GG D ++ ++ S+ R AFI+S + +A + F G+DL Sbjct: 76 TETVKEKNTDVQTLLSIGGK-DADKAVLASMASNSKN-RKAFIDSSIDIARKKDFYGLDL 133 Query: 489 AWQFP 503 AW++P Sbjct: 134 AWEYP 138 >At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 362 Score = 43.2 bits (97), Expect = 1e-04 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 2/102 (1%) Frame = +3 Query: 204 THLLYGYAGIQPDTYKL-VSLNENLDIDR-THDNYRAITSLKAKYPGLTVLLSVGGDADT 377 THL +A + T+++ +S + + TH ++K K + LLS+GG D Sbjct: 38 THLFCAFADVDSSTHEVTISAANSCQVSSFTH-------TVKDKNTDVQTLLSIGGK-DA 89 Query: 378 EEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAWQFP 503 ++ ++ S+ R AFI+S + +A + F G+DLAW++P Sbjct: 90 DKAVLASMASNSKN-RKAFIDSSIDIARKKDFYGLDLAWEYP 130 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 41.9 bits (94), Expect = 3e-04 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 402 LLESQQARTAFINSGVLLAEQYGFDGIDLAWQFPR 506 + S R +FI S + +A YGFDG+DL W++PR Sbjct: 1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPR 35 >At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 289 Score = 38.3 bits (85), Expect = 0.004 Identities = 13/34 (38%), Positives = 25/34 (73%) Frame = +3 Query: 402 LLESQQARTAFINSGVLLAEQYGFDGIDLAWQFP 503 ++ ++ +R +FI+S + +A GF G+DLAW++P Sbjct: 79 IVSNRTSRESFISSSISIARSLGFYGLDLAWEYP 112 >At1g61810.1 68414.m06972 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase (GI:3820531) [Pinus contorta]; similar to beta-glucosidase GI:804655 from (Hordeum vulgare) Length = 520 Score = 30.7 bits (66), Expect = 0.77 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 5/99 (5%) Frame = +3 Query: 219 GYAGIQPDTYKLVSLNENLDIDRTHDN----YRAITSLKAKYPGLTVLLSVGGDADTEEP 386 GYA ++ D V++ E D++ H + ++ + LK +YP + + ++ G D ++P Sbjct: 368 GYA-LKLDRKGNVTIGELTDVNWQHIDPTGFHKMLNYLKDRYPNMPMFITENGFGDLQKP 426 Query: 387 EKYNLLLESQQARTAFINSGVLLAEQYGF-DGIDLAWQF 500 E + L + R ++ SG L A Q DG ++ F Sbjct: 427 ETTDKELLNDTKRIQYM-SGYLEALQAAMRDGANVKGYF 464 >At4g15960.1 68417.m02423 epoxide hydrolase, putative similar to epoxide hydrolase [Solanum tuberosum] GI:407944; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 375 Score = 30.3 bits (65), Expect = 1.0 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 6/69 (8%) Frame = +3 Query: 342 TVLLSVGGDADTEEPEK---YNLLLESQQ--ARTAFINSGVLLAEQYGFD-GIDLAWQFP 503 T+ + G DTE PEK Y LL + A + G G D G +AWQ Sbjct: 109 TIAPDLRGYGDTEAPEKVEDYTLLKRGRSVVALIVAVTGGDKAVSVVGHDWGAMIAWQLC 168 Query: 504 RVKPKKIRS 530 + +P+K+++ Sbjct: 169 QYRPEKVKA 177 >At5g40470.1 68418.m04908 expressed protein Length = 496 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -3 Query: 523 IFLGLTLGNCQARSIPSKPYCSANSTPELMKAVRACCDSSRRLYFSGSSVSAS 365 I+ G+T+G +RS + EL+ + +CC + R L F + VS+S Sbjct: 85 IYRGVTIGTTPSRSDEEHLKAETIFSDELISIISSCCFNLRNLCFLINPVSSS 137 >At2g19640.2 68415.m02295 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 398 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 496 CQARSIPS--KPYCSANSTPELMKAVRACCDSSRRLYFSGSSVSASPPTD 353 CQ+ S+ S P C A+ TP L C+S RRL+ S SS + P+D Sbjct: 75 CQSCSLVSFCSPNCFASHTPWL-------CESLRRLHQSSSSAFSDQPSD 117 >At2g19640.1 68415.m02294 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 341 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 496 CQARSIPS--KPYCSANSTPELMKAVRACCDSSRRLYFSGSSVSASPPTD 353 CQ+ S+ S P C A+ TP L C+S RRL+ S SS + P+D Sbjct: 75 CQSCSLVSFCSPNCFASHTPWL-------CESLRRLHQSSSSAFSDQPSD 117 >At5g18820.1 68418.m02236 chaperonin, putative similar to SWISS-PROT:P08926- RuBisCO subunit binding-protein alpha subunit, chloroplast precursor (60 kDa chaperonin alpha subunit, CPN-60 alpha)[Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 575 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 2/89 (2%) Frame = +3 Query: 276 DIDRTHDNY--RAITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGV 449 D+ T ++Y + I AK G ++ VGG +TE ++ + +++ A A + G+ Sbjct: 383 DLAETDNSYLSKKIAERIAKLTGGVAVIKVGGHTETELEDRKLRIEDAKNATFAAMREGI 442 Query: 450 LLAEQYGFDGIDLAWQFPRVKPKKIRSTW 536 + G I L + PR+K + ++ Sbjct: 443 VPGG--GATYIHLLDEIPRIKKNLMEDSY 469 >At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 551 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 210 LLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITS 317 LLYGY+G+ +KL L+ +RT ++ A+ S Sbjct: 130 LLYGYSGMAEHAHKLFDEMPELNCERTVKSFNALLS 165 >At2g33210.1 68415.m04069 chaperonin, putative similar to SWISS-PROT:Q05046- chaperonin CPN60-2, mitochondrial precursor (HSP60-2) [Cucurbita maxima]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 585 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 324 AKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVL 452 AK G +L +GG ++TE EK + + ++ A A + G++ Sbjct: 401 AKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIV 443 >At3g09080.1 68416.m01067 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats; similar to JNK-binding protein JNKBP1 (GP:6069583) [Mus musculus] Length = 1026 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 538 PQVERIFLGLTLGNCQARSIPSKPYCSANST 446 PQ IF ++LGN Q +S PS+ Y S+N + Sbjct: 147 PQTSVIF-HVSLGNIQIQSFPSRAYFSSNKS 176 >At3g23990.1 68416.m03013 chaperonin (CPN60) (HSP60) identical to SWISS-PROT:P29197- chaperonin CPN60, mitochondrial precursor (HSP60) [Arabidopsis thaliana] Length = 577 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 324 AKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVL 452 AK G +L +GG ++ E EK + + ++ A A + G+L Sbjct: 400 AKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIL 442 >At5g54630.1 68418.m06802 zinc finger protein-related contains Prosite:PS00028 Zinc finger, C2H2 type, domain Length = 472 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -1 Query: 228 RHSRTASGCRTTERDRGPTAACGLEIL*HSSCCRSNKVLCCGLPQVG 88 +H R + R G T ACGL I +S C + K C + + G Sbjct: 320 KHPRCLADGNELLRFHGTTVACGLGINGSTSVCTAEKCCVCRIIRNG 366 >At4g17020.2 68417.m02567 transcription factor-related contains weak similarity to Swiss-Prot:Q92759 TFIIH basal transcription factor complex p52 subunit (Basic transcription factor 52 kDa subunit, BTF2-p52, General transcription factor IIH polypeptide 4) [Homo sapiens] Length = 462 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = -2 Query: 563 FLIPCQKRSPGRADLLRLN---SWELPGEVNSIETILFSQQHSGINESSTGLLRFQQKVI 393 +++ ++R ADL+ S+ + G+ ++ T+ Q ++ + + GL++ QQ Sbjct: 212 YILNAEERDVDPADLISFLLELSFHVTGQAYNLNTLTEVQNNTLKDLADLGLVKLQQGRK 271 Query: 392 FFWFFGISVATN 357 WF +ATN Sbjct: 272 DSWFIPTKLATN 283 >At4g17020.1 68417.m02568 transcription factor-related contains weak similarity to Swiss-Prot:Q92759 TFIIH basal transcription factor complex p52 subunit (Basic transcription factor 52 kDa subunit, BTF2-p52, General transcription factor IIH polypeptide 4) [Homo sapiens] Length = 452 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = -2 Query: 563 FLIPCQKRSPGRADLLRLN---SWELPGEVNSIETILFSQQHSGINESSTGLLRFQQKVI 393 +++ ++R ADL+ S+ + G+ ++ T+ Q ++ + + GL++ QQ Sbjct: 212 YILNAEERDVDPADLISFLLELSFHVTGQAYNLNTLTEVQNNTLKDLADLGLVKLQQGRK 271 Query: 392 FFWFFGISVATN 357 WF +ATN Sbjct: 272 DSWFIPTKLATN 283 >At4g03450.1 68417.m00472 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 641 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -2 Query: 560 LIPCQKRSPGRADLLRLNSWELPGEVNSIETILFSQQHSG 441 +I C G +L N ++LPGE S+ +FS +G Sbjct: 8 IIDCITGDTGSIQMLVTNLYDLPGEYVSMNPEIFSAMRAG 47 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 279 IDRTHDNYRAITSLKAKYPGLTVLLSVGGDA 371 +DR +Y A+T LKA G+ LLS G D+ Sbjct: 305 LDRATAHYGAVTGLKATNDGM-YLLSAGSDS 334 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,724,376 Number of Sequences: 28952 Number of extensions: 256749 Number of successful extensions: 818 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -