BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1055 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 23 1.3 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 23 1.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 1.8 EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport pe... 21 4.0 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 21 7.1 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 20 9.4 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 23.0 bits (47), Expect = 1.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 188 NGDPNPTRSGLRVPATITW 244 NGDPNPT + +TW Sbjct: 474 NGDPNPTEENPLI--NVTW 490 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 23.0 bits (47), Expect = 1.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 188 NGDPNPTRSGLRVPATITW 244 NGDPNPT + +TW Sbjct: 474 NGDPNPTEENPLI--NVTW 490 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 327 IIGGQVXQPLLGEVMDXEERVSGXSDAVQV 238 + GGQV PL+G + + +S +A V Sbjct: 438 VCGGQVKYPLIGAMREELRGISRGKNAKDV 467 >EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport peptide isoform A protein. Length = 140 Score = 21.4 bits (43), Expect = 4.0 Identities = 12/57 (21%), Positives = 20/57 (35%) Frame = +1 Query: 121 NECTSACGTSXFRSXXFNYLRRKRXPESXKIWTPSARDNNLDSITXPRYPFFXVHNL 291 N C C T+ + + L+R ++W R L + PF + L Sbjct: 83 NLCRKNCFTTDYFKGCIDTLQRSDEEAQIQLWIKQIRGAELGGLGTLIAPFLFSNTL 139 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 20.6 bits (41), Expect = 7.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 240 VIVAGTRSPDLVGFGSPFPP 181 +I+AG SP ++G+ F P Sbjct: 32 LIIAGCVSPFVIGYVKHFHP 51 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 Query: 182 GGNGDPNPTRSGLRVPA 232 GG P P RS +PA Sbjct: 327 GGRRGPGPARSRRHLPA 343 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,762 Number of Sequences: 336 Number of extensions: 1272 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -