BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1055 (450 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 6.2 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.2 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 8.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 8.2 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.0 bits (42), Expect = 6.2 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = -2 Query: 140 HAEVHSLPHESH 105 H+ +H+ PH H Sbjct: 423 HSHIHATPHHHH 434 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 20.6 bits (41), Expect = 8.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 46 ITAILSLMLIGTTLWAXSLSCDSCGNECTSACGTSXFRS 162 + +L +++I T L S D C + S C T +R+ Sbjct: 541 VVVLLVIIIIMTVLILRRAS-DECNKKQPSDCDTLEYRN 578 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 220 PSARDNNLDSITXPRY 267 P+A + + +T PRY Sbjct: 384 PNAEERRVQGVTKPRY 399 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 220 PSARDNNLDSITXPRY 267 P+A + + +T PRY Sbjct: 299 PNAEERRVQGVTKPRY 314 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 220 PSARDNNLDSITXPRY 267 P+A + + +T PRY Sbjct: 618 PNAEERRVQGVTKPRY 633 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,065 Number of Sequences: 438 Number of extensions: 1291 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -