BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1053 (467 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 1.4 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 1.4 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 1.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.3 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 211 LWRTDLANMASTSTAAAFKMVEIFSPVTATSSSTRM 104 LW + + + STA A + P + S ST++ Sbjct: 175 LWYINCRAVGNASTALAESFQNVLVPTASNSKSTKV 210 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 211 LWRTDLANMASTSTAAAFKMVEIFSPVTATSSSTRM 104 LW + + + STA A + P + S ST++ Sbjct: 175 LWYINCRAVGNASTALAESFQNVLVPTASNSKSTKV 210 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 211 LWRTDLANMASTSTAAAFKMVEIFSPVTATSSSTRM 104 LW + + + STA A + P + S ST++ Sbjct: 175 LWYINCRAVGNASTALAESFQNVLVPTASNSKSTKV 210 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 4.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 234 TDIDAFQGFGEQTWPI 187 TD+D F+G WP+ Sbjct: 515 TDLDDFKGVCGMKWPL 530 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,706 Number of Sequences: 336 Number of extensions: 1684 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -