BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1045 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.7 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 2.7 AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. 24 4.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 4.8 AY146718-1|AAO12078.1| 149|Anopheles gambiae odorant-binding pr... 23 8.4 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -3 Query: 645 KRCKSARYIRYVYKDT*ILRLRRHYDHSRLVQIQKL---SYDVD*KI*VRQECLRILRMS 475 KR Y+Y ++ ILR HY+ V + ++ +Y K+ +R+ + + R S Sbjct: 1937 KRTPDGGTYEYIYSESGILRFSIHYNAPERVNMDRVVHFTYSSHGKV-MREALVNLTRES 1995 Query: 474 IAQI 463 QI Sbjct: 1996 CYQI 1999 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 544 KIILRRRLKNISPPGMFKNIKDVNSTNTSDNQL 446 +I L+ N+ PG+F ++K + + S+N+L Sbjct: 286 EIYLQNNSLNVLAPGIFSDLKQLLVLDLSNNEL 318 >AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. Length = 93 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 59 WLDCF*FWSHSISPRLILQVHLDRYAHSY 145 WL F W + + RLI +V Y + Y Sbjct: 30 WLPIFLGWENMVKNRLIYRVKGGEYINDY 58 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -2 Query: 544 KIILRRRLKNISPPGMFKNIKDVNSTNTSDNQL 446 +I L+ ++ PG+F ++ + + + S NQL Sbjct: 322 EIYLQNNSISVLSPGLFSKLEQLQALDLSQNQL 354 >AY146718-1|AAO12078.1| 149|Anopheles gambiae odorant-binding protein AgamOBP13 protein. Length = 149 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 458 RCICAIDILNILKHS 502 RC A+DI+N LK S Sbjct: 125 RCELAVDIMNCLKES 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,964 Number of Sequences: 2352 Number of extensions: 12744 Number of successful extensions: 70 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -