BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1044 (800 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 27 0.15 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 1.4 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 7.6 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 27.5 bits (58), Expect = 0.15 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 472 VIEPNTELDRNGRSVSQPASTTDISTPVSGSVSS 371 V+E N+ N R S P+S+T S P G+ ++ Sbjct: 504 VVETNSSPSPNPRIASAPSSSTSSSPPAKGAAAA 537 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 3 HPPAGTRXTPPIQLSRVLQGHRQEVCGLKWSP 98 + P+ R I+ + V+ G ++ VCG+K P Sbjct: 517 YEPSACRPRHEIRSTDVIPGTQEHVCGVKGIP 548 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.5 Identities = 9/35 (25%), Positives = 15/35 (42%) Frame = -2 Query: 193 TCAEYVCTGDVECIDQTKSLLSLPPEANDWPSGDH 89 TC + +G V C+ K + + + WP H Sbjct: 148 TCLVF-SSGSVSCVPSVKHVAKCATDFSSWPYDTH 181 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect = 7.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 572 GRSCSPCVRAFWKKHSKNRSVSSPAPVTMASPS 474 G SC P A SK RSVS + T +S S Sbjct: 153 GSSCGPGAAAAAALLSKRRSVSECSLGTASSTS 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,450 Number of Sequences: 438 Number of extensions: 3995 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -