BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1043 (400 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68751-1|CAA92971.1| 210|Caenorhabditis elegans Hypothetical pr... 114 3e-26 U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical pr... 27 6.5 >Z68751-1|CAA92971.1| 210|Caenorhabditis elegans Hypothetical protein T05E11.1 protein. Length = 210 Score = 114 bits (274), Expect = 3e-26 Identities = 53/76 (69%), Positives = 59/76 (77%) Frame = +2 Query: 173 AADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVE 352 A + PE+ LFG+WS V VSD+SL DYI VKEK AKYLPHSAGR+ +RFRKA CPIVE Sbjct: 17 ATEAPEVALFGKWSLQSVNVSDISLVDYIPVKEKSAKYLPHSAGRFQVRRFRKAACPIVE 76 Query: 353 RLTNSLMMXGRXNGXK 400 RL NSLMM GR NG K Sbjct: 77 RLANSLMMHGRNNGKK 92 >U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical protein C25H3.8 protein. Length = 2148 Score = 26.6 bits (56), Expect = 6.5 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +2 Query: 101 AEENWNDDVAE--AGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQ 250 A +N++D + E AG V +L + +K + + C+ ++V DMS+Q Sbjct: 1697 AGQNYDDQMLELPAGIPVTGRPALKLEMNCTSMKHYDSFDCFRLKVCDMSVQ 1748 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,898,717 Number of Sequences: 27780 Number of extensions: 142564 Number of successful extensions: 338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 619699724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -