BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1041 (800 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 5.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.8 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 7.6 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 7.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 7.6 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 63 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 100 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 63 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 100 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 63 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 100 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 63 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 100 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 63 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 100 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 63 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 100 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 63 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 100 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 5.8 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -1 Query: 479 SLKLAYFPYDQFICV 435 ++ + YFP+DQ C+ Sbjct: 152 TIDVTYFPFDQQTCI 166 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 312 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 349 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 312 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 349 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 312 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 349 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 312 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 349 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 312 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 349 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 312 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 349 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 312 SRERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 349 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.6 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 664 IVLSXRISTTMRSCAFVKFYKGDAXLRSFGELHHYWTCFDIL 789 ++ S RIS T+ +K Y D + S + WT D++ Sbjct: 148 VLYSIRISLTLSCPMNLKLYPLDRQVCSLRMASYGWTTDDLV 189 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.6 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 664 IVLSXRISTTMRSCAFVKFYKGDAXLRSFGELHHYWTCFDIL 789 ++ S RIS T+ +K Y D + S + WT D++ Sbjct: 148 VLYSIRISLTLSCPMNLKLYPLDRQVCSLRMASYGWTTDDLV 189 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 7.6 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 699 SHSRGDSSRQNDPSRDLWIRHIQLIDEVPKKIHYNLYP 586 S R R+ SR+ I I+++P ++Y +P Sbjct: 296 SKERSRDRRERGRSREHRIIPSHYIEQIPVPVYYGNFP 333 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,661 Number of Sequences: 438 Number of extensions: 5363 Number of successful extensions: 34 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -