BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1039 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPYUG7.02c |sin1||stress activated MAP kinase interacting prot... 27 2.2 SPCC31H12.02c |mug73||membrane transporter |Schizosaccharomyces ... 27 3.8 SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pomb... 27 3.8 SPBC21H7.05 |sfc6||transcription factor TFIIIC complex subunit S... 26 5.0 SPAC25G10.08 |||translation initiation factor eIF3b |Schizosacch... 26 6.6 SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom... 26 6.6 SPCC965.10 |||transcription factor |Schizosaccharomyces pombe|ch... 25 8.7 >SPAPYUG7.02c |sin1||stress activated MAP kinase interacting protein Sin1|Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 27.5 bits (58), Expect = 2.2 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 5/92 (5%) Frame = +3 Query: 126 FPAQRKHLVAFKGKRYVHGIGSETRN-----SLWHLHDGNNLILVTTCRHGKSWKDLRDE 290 F + + L+A G+ YVH + SE++N +H G+ ++ C+ K + Sbjct: 572 FMGRHERLLAIDGE-YVHIMPSESKNIFETPKTSSIHAGSIIL----CKQSKK-SPCNFK 625 Query: 291 RCEEDNKEYDKFDYEQLLANSTFCIVARGRRL 386 N+E ++D+E L A IV+R R L Sbjct: 626 MIVSKNRETKRYDFEVLSALEAAIIVSRIRAL 657 >SPCC31H12.02c |mug73||membrane transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 306 Score = 26.6 bits (56), Expect = 3.8 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 4 YWPEQVLPK*CFVRDLTFHCHYFIKNIQRKEEFHLLLLSTHFRLNVSI 147 Y + V F R+++ Y+++ IQ F L+++ H+ + VSI Sbjct: 78 YGLKNVFSSASFFREVSVRMVYYVRYIQWLINFPLIIVMLHWTVGVSI 125 >SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 631 Score = 26.6 bits (56), Expect = 3.8 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = +3 Query: 150 VAFKGKRYVHGIG----SETRNSLWHLHDGNNLILVTTCRHGKSWKDLRDE-RCEEDNKE 314 + F+GK+Y+ G S R ++ HL G I V+ S L DE DN Sbjct: 470 INFQGKQYMKLSGIIVTSNYRKNVLHLVVGCG-INVSNLGPTVSLNTLVDEWNKNSDNPR 528 Query: 315 YDKFDYEQLLAN 350 +KF +E+LLA+ Sbjct: 529 LEKFSFEKLLAS 540 >SPBC21H7.05 |sfc6||transcription factor TFIIIC complex subunit Sfc6|Schizosaccharomyces pombe|chr 2|||Manual Length = 582 Score = 26.2 bits (55), Expect = 5.0 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 330 NQTCHILYCPLHIFHLLNLSKIFHDGKWLLRSSYF 226 +Q C + Y P H ++ N+ + D WL ++ F Sbjct: 364 SQECPLFYIPYHDSYIHNVVQCLDDFPWLFLTTAF 398 >SPAC25G10.08 |||translation initiation factor eIF3b |Schizosaccharomyces pombe|chr 1|||Manual Length = 725 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 363 IVARGRRLGSYRFLEALAAGCIPVLLSNGWRLPFDEK 473 +V ++ +RFL + I + NG+ +PF+EK Sbjct: 48 VVEEAKQQDFFRFLSSKVLAKIGKVKENGFYMPFEEK 84 >SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1158 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 121 THFRLNVS-IW*PSKEKDMYMVLVVKPV 201 T F+ +S +W S E+DM++ L +KP+ Sbjct: 169 TLFQKKLSRVWTTSSERDMFLSLFLKPI 196 >SPCC965.10 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 525 Score = 25.4 bits (53), Expect = 8.7 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 738 SQCSEGS-W*SIPKLEDLVALKLDEREHVPVK 646 SQ EG W +P+ ED+ + KLD + P++ Sbjct: 370 SQTIEGKIWSCVPQYEDMKSNKLDSEKSEPLQ 401 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,141,937 Number of Sequences: 5004 Number of extensions: 66025 Number of successful extensions: 192 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 192 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -