BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1034 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3... 237 6e-63 At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2... 100 1e-21 At2g20140.1 68415.m02353 26S protease regulatory complex subunit... 100 1e-21 At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4... 71 9e-13 At1g45000.1 68414.m05158 26S proteasome regulatory complex subun... 70 2e-12 At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, put... 62 2e-10 At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5... 62 3e-10 At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, puta... 59 2e-09 At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) 59 3e-09 At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, puta... 46 2e-05 At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1... 45 4e-05 At1g65540.1 68414.m07435 calcium-binding EF hand family protein ... 36 0.031 At5g55490.1 68418.m06911 expressed protein 35 0.054 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 32 0.38 At1g03080.1 68414.m00282 kinase interacting family protein simil... 31 0.50 At5g32169.1 68418.m03692 hypothetical protein 30 1.5 At4g14760.1 68417.m02271 M protein repeat-containing protein con... 30 1.5 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 30 1.5 At5g47510.1 68418.m05866 SEC14 cytosolic factor family protein /... 29 2.7 At1g78310.1 68414.m09126 VQ motif-containing protein contains PF... 29 2.7 At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)... 29 3.5 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 28 4.7 At3g19670.1 68416.m02492 FF domain-containing protein / WW domai... 28 4.7 At3g19370.1 68416.m02457 expressed protein 28 4.7 At5g40540.1 68418.m04920 protein kinase, putative similar to pro... 28 6.2 At3g62670.1 68416.m07040 two-component responsive regulator fami... 28 6.2 At2g41880.1 68415.m05179 guanylate kinase 1 (GK-1) identical to ... 28 6.2 At2g27600.1 68415.m03346 AAA-type ATPase family protein / vacuol... 28 6.2 At1g77890.1 68414.m09078 expressed protein 28 6.2 At1g69910.1 68414.m08045 protein kinase family protein contains ... 28 6.2 At1g47760.1 68414.m05311 MADS-box protein (AGL102) contains simi... 28 6.2 At5g03340.1 68418.m00286 cell division cycle protein 48, putativ... 27 8.2 At4g21750.1 68417.m03148 L1 specific homeobox gene (ML1) / ovule... 27 8.2 At1g29000.1 68414.m03546 heavy-metal-associated domain-containin... 27 8.2 >At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3) identical to 26S proteasome AAA-ATPase subunit RPT3 GI:6652882 from [Arabidopsis thaliana] Length = 408 Score = 237 bits (579), Expect = 6e-63 Identities = 113/143 (79%), Positives = 125/143 (87%) Frame = +2 Query: 185 ESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFXEA 364 + EDLY + K L+R LEF ++QEEY+KDEQ+NLK+E L AQEEVKRIQSVPLVIGQF E Sbjct: 26 DEEDLYGRLKSLERQLEFTDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEM 85 Query: 365 VDQNTGIVGSTTGSNYYVRXLSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQ 544 VDQN GIVGSTTGSNYYVR LSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L Sbjct: 86 VDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS 145 Query: 545 ADEKPDVQYSDIGGMDTQKQEIR 613 EKPDV Y+DIGG D QKQEIR Sbjct: 146 QSEKPDVSYNDIGGCDIQKQEIR 168 >At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2a) almost identical to 26S proteasome AAA-ATPase subunit RPT2a (GI:6652880) {Arabidopsis thaliana}; Drosophila melanogaster 26S proteasome subunit 4 ATPase, PID:g1066065 Length = 443 Score = 100 bits (239), Expect = 1e-21 Identities = 52/158 (32%), Positives = 95/158 (60%), Gaps = 7/158 (4%) Frame = +2 Query: 161 GPQSFDELESEDLYTKYK----KLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEE---VK 319 GP++ L + TK K KL+R+ ++L ++EE++ +++R LK + A+E+ V Sbjct: 45 GPEAAARLPTVTPSTKCKLRLLKLERIKDYLLMEEEFVANQER-LKPQEEKAEEDRSKVD 103 Query: 320 RIQSVPLVIGQFXEAVDQNTGIVGSTTGSNYYVRXLSTIDRELLKPSASVALHKHSNALV 499 ++ P+ +G E +D+N IV S+ G YYV LS +D++ L+P S+ +H ++V Sbjct: 104 DLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVV 163 Query: 500 DVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIR 613 +L E D +S+++ ++ P Y+DIGG++ Q QEI+ Sbjct: 164 GILQDEVDPMVSVMKVEKAPLESYADIGGLEAQIQEIK 201 >At2g20140.1 68415.m02353 26S protease regulatory complex subunit 4, putative similar to Swiss-Prot:P48601 26S protease regulatory subunit 4 (P26S4) [Drosophila melanogaster] Length = 443 Score = 100 bits (239), Expect = 1e-21 Identities = 52/158 (32%), Positives = 95/158 (60%), Gaps = 7/158 (4%) Frame = +2 Query: 161 GPQSFDELESEDLYTKYK----KLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEE---VK 319 GP++ L + TK K KL+R+ ++L ++EE++ +++R LK + A+E+ V Sbjct: 45 GPEAAARLPTVTPSTKCKLRLLKLERIKDYLLMEEEFVANQER-LKPQEEKAEEDRSKVD 103 Query: 320 RIQSVPLVIGQFXEAVDQNTGIVGSTTGSNYYVRXLSTIDRELLKPSASVALHKHSNALV 499 ++ P+ +G E +D+N IV S+ G YYV LS +D++ L+P S+ +H ++V Sbjct: 104 DLRGTPMSVGNLEELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVV 163 Query: 500 DVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIR 613 +L E D +S+++ ++ P Y+DIGG++ Q QEI+ Sbjct: 164 GILQDEVDPMVSVMKVEKAPLESYADIGGLEAQIQEIK 201 >At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4a) gb|AAF22524.1 Length = 399 Score = 70.5 bits (165), Expect = 9e-13 Identities = 39/143 (27%), Positives = 73/143 (51%) Frame = +2 Query: 203 TKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFXEAVDQNTG 382 ++Y+K + LE + ++ R KKE+ ++++K +QSV +IG+ +D Sbjct: 16 SEYRKKLLQHKELESRVRTARENLRGAKKEFNKTEDDLKSLQSVGQIIGEVLRPLDNERL 75 Query: 383 IVGSTTGSNYYVRXLSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPD 562 IV +++G Y V S +D+E L V L + ++ LP E D + + ++ + Sbjct: 76 IVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGN 135 Query: 563 VQYSDIGGMDTQKQEIRGSC*TP 631 + YS +GG+ Q +E+R S P Sbjct: 136 ISYSAVGGLGDQIRELRESIELP 158 >At1g45000.1 68414.m05158 26S proteasome regulatory complex subunit p42D, putative similar to 26S proteasome regulatory complex subunit p42D [Drosophila melanogaster] gi|6434958|gb|AAF08391 Length = 399 Score = 69.7 bits (163), Expect = 2e-12 Identities = 40/143 (27%), Positives = 72/143 (50%) Frame = +2 Query: 203 TKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFXEAVDQNTG 382 T Y+K + LE + ++ R KKE+ ++++K +QSV +IG+ +D Sbjct: 16 TDYRKKLLHHKELESRVRTARENLRAAKKEFNKTEDDLKSLQSVGQIIGEVLRPLDNERL 75 Query: 383 IVGSTTGSNYYVRXLSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPD 562 IV +++G Y V S +D+E L V L + ++ LP E D + + ++ + Sbjct: 76 IVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGN 135 Query: 563 VQYSDIGGMDTQKQEIRGSC*TP 631 + YS +GG+ Q +E+R S P Sbjct: 136 ISYSAVGGLGDQIRELRESIELP 158 >At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, putative identical to SP:O04019 from [Arabidopsis thaliana] Length = 423 Score = 62.5 bits (145), Expect = 2e-10 Identities = 41/174 (23%), Positives = 84/174 (48%), Gaps = 21/174 (12%) Frame = +2 Query: 152 AFAGPQSFDELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQS 331 +F G Q + ++D+ + L + L+ + + + ++K++ QE++K + Sbjct: 10 SFEGDQ-LASMTTDDIGRASRLLANEIRILKEESQRTNLDLESVKEKIKENQEKIKLNKQ 68 Query: 332 VPLVIGQFXEAVD------------------QNTG---IVGSTTGSNYYVRXLSTIDREL 448 +P ++G E ++ Q G ++ ++T ++ + +D + Sbjct: 69 LPYLVGNIVEILEMSPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGLVDPDT 128 Query: 449 LKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEI 610 LKP V ++K S ++D LP E DS + ++ DEKP Y+DIGG++ Q QE+ Sbjct: 129 LKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQEL 182 >At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5a) identical to GB:AAF22525 GI:6652886 from [Arabidopsis thaliana] Length = 424 Score = 62.1 bits (144), Expect = 3e-10 Identities = 39/164 (23%), Positives = 77/164 (46%), Gaps = 21/164 (12%) Frame = +2 Query: 182 LESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFXE 361 + +ED+ + L + L+ + E + K++ QE++K + +P ++G E Sbjct: 20 MSTEDITRATRLLDNEIRILKEDAQRTNLECDSYKEKIKENQEKIKLNKQLPYLVGNIVE 79 Query: 362 AVDQNTG---------------------IVGSTTGSNYYVRXLSTIDRELLKPSASVALH 478 ++ N ++ ++T ++ + +D + LKP V ++ Sbjct: 80 ILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGLVDPDSLKPGDLVGVN 139 Query: 479 KHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEI 610 K S ++D LP E DS + ++ DEKP Y+DIGG++ Q QE+ Sbjct: 140 KDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQEL 183 >At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, putative almost identical to 26S proteasome AAA-ATPase subunit RPT6a GI:6652888 from [Arabidopsis thaliana]; almost identical to a member of conserved Sug1 CAD family AtSUG1 GI:13537115 from [Arabidopsis thaliana] Length = 419 Score = 59.3 bits (137), Expect = 2e-09 Identities = 36/133 (27%), Positives = 64/133 (48%) Frame = +2 Query: 215 KLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFXEAVDQNTGIVGS 394 +LQR+ ++ ++ L +EE++ +Q +G+ + + +N +V Sbjct: 42 ELQRLQREKSYNLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKV 101 Query: 395 TTGSNYYVRXLSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYS 574 Y V +ID L PS VAL S L VLP + D +++++ ++ PD Y Sbjct: 102 HPEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYD 161 Query: 575 DIGGMDTQKQEIR 613 IGG+D Q +EI+ Sbjct: 162 MIGGLDQQIKEIK 174 >At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) Length = 419 Score = 58.8 bits (136), Expect = 3e-09 Identities = 36/133 (27%), Positives = 64/133 (48%) Frame = +2 Query: 215 KLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFXEAVDQNTGIVGS 394 +LQR L ++ ++ L +EE++ +Q +G+ + + +N +V Sbjct: 42 ELQRQLRQKTNNLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKV 101 Query: 395 TTGSNYYVRXLSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYS 574 Y V +ID + PS VAL S L VLP + D +++++ ++ PD Y Sbjct: 102 HPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYD 161 Query: 575 DIGGMDTQKQEIR 613 IGG+D Q +EI+ Sbjct: 162 MIGGLDQQIKEIK 174 >At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, putative similar to 26S proteasome AAA-ATPase subunit RPT1 SP:Q41365 from [Spinacia oleracea] Length = 464 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +2 Query: 506 LPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIR 613 LPP+ D S++M+ +EKPD YSDIGG Q ++IR Sbjct: 183 LPPKIDPSVTMMTVEEKPDATYSDIGGCKEQIEKIR 218 >At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1a) similar to 26S proteasome ATPase subunit GI:1395190 from [Spinacia oleracea] Length = 426 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/36 (47%), Positives = 27/36 (75%) Frame = +2 Query: 506 LPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIR 613 LPP+ D S++M+ +EKPDV Y+D+GG Q +++R Sbjct: 146 LPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMR 181 >At1g65540.1 68414.m07435 calcium-binding EF hand family protein similar to leucine zipper-EF-hand containing transmembrane protein 1 [Homo sapiens] GI:4235226; contains Pfam profile PF00036: EF hand Length = 736 Score = 35.5 bits (78), Expect = 0.031 Identities = 33/121 (27%), Positives = 56/121 (46%) Frame = +2 Query: 182 LESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFXE 361 L SED ++ K R LE+LE+QEE IK+E+ ++E +E + V L Sbjct: 485 LSSEDSVSERK---RKLEYLEMQEELIKEEEEEEEEEMAKMKESASSQKDVALDEMMAST 541 Query: 362 AVDQNTGIVGSTTGSNYYVRXLSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISML 541 A D N T + + LS +L ++SV++ + + ++ E D SM+ Sbjct: 542 AKDANEQAKAKTLEKHEQLCELSRA-LAVLASASSVSMEREE--FLKLVKKEVDLYNSMV 598 Query: 542 Q 544 + Sbjct: 599 E 599 >At5g55490.1 68418.m06911 expressed protein Length = 537 Score = 34.7 bits (76), Expect = 0.054 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 3/89 (3%) Frame = +2 Query: 62 TKSLSYRNNGRDWNYFTRXKMTKSQX---SKGLAFAGPQSFDELESEDLYTKYKKLQRML 232 TK + ++ D TR + K Q + +A G Q +SE L LQR+ Sbjct: 248 TKMIDLQSTTDDIGTKTRSSLDKQQKLLDGQTVALDGIQFLTRFQSEALQESRNTLQRLK 307 Query: 233 EFLEVQEEYIKDEQRNLKKEYLHAQEEVK 319 EF + Q+E + Q L++ + H E K Sbjct: 308 EFSQEQQEDLAKRQEKLQEVHDHLFENSK 336 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 31.9 bits (69), Expect = 0.38 Identities = 16/70 (22%), Positives = 37/70 (52%) Frame = +2 Query: 119 KMTKSQXSKGLAFAGPQSFDELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYL 298 K K + L G +++ ++ K L++ +++ E++++ IKD+ L++E Sbjct: 700 KKNKEDFEQQLENIGSIREMQMKESEISGKISGLEKKIQYAEIEKKSIKDKLPQLEQEER 759 Query: 299 HAQEEVKRIQ 328 + EE+ RI+ Sbjct: 760 NIIEEIDRIK 769 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 31.5 bits (68), Expect = 0.50 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +2 Query: 179 ELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRI 325 E E E L K KL E E+Q + D +LK + HAQEE +R+ Sbjct: 380 EGEVESLKQKVSKLIEENEAYELQYQQCLDTIADLKLKLFHAQEETQRL 428 >At5g32169.1 68418.m03692 hypothetical protein Length = 258 Score = 29.9 bits (64), Expect = 1.5 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = -2 Query: 307 LCMQIFFLQVSLFIFNVLFLY 245 LC ++F +++SL++F++ FLY Sbjct: 204 LCSRLFVIRISLYLFSIQFLY 224 >At4g14760.1 68417.m02271 M protein repeat-containing protein contains Pfam profile: PF02370 M protein repeat Length = 1676 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +2 Query: 179 ELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFX 358 E E + L + KL + E L V+ + + L++E HAQ+ KR+ S L Sbjct: 292 ETEIKALKQELLKLNEVNEDLNVRYQQCLETISKLEREVSHAQDNAKRLSSEVLAGAAKI 351 Query: 359 EAVDQNTGIVGS 394 + V++ ++ S Sbjct: 352 KTVEEQCALLES 363 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/38 (47%), Positives = 27/38 (71%) Frame = +2 Query: 221 QRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSV 334 +R LE+LE+QEE IK+E+ +KE +EE+ RI+ V Sbjct: 516 RRKLEYLEMQEELIKEEE---EKE----EEELTRIKDV 546 >At5g47510.1 68418.m05866 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus], SEC14 cytosolic factor (Phosphatidylinositol/phosphatidylcholine transfer protein) (PI/PCTP) (SP:P24859) [Kluyveromyces lactis] and to SEC14 cytosolic factor (SP:P53989) [Candida glabrata] Length = 376 Score = 29.1 bits (62), Expect = 2.7 Identities = 26/120 (21%), Positives = 53/120 (44%), Gaps = 2/120 (1%) Frame = +2 Query: 155 FAGPQSFDELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSV 334 F + FD +S++ + Y K + + + +++ +E +KK Y H +V + Sbjct: 54 FLKMRDFDLEKSKEAFLNYMKWRVDYKVDLISQKFKFEEYGEVKKHYPHGFHKVDK-TGR 112 Query: 335 PLVIGQFXEAVDQNTGIVGSTTGS--NYYVRXLSTIDRELLKPSASVALHKHSNALVDVL 508 P+ I + D N + +T NY+++ L P+ S+A KH ++ +L Sbjct: 113 PIYIERLG-MTDLNAFLKATTIERYVNYHIKEQEK-TMSLRYPACSIASDKHVSSTTTIL 170 >At1g78310.1 68414.m09126 VQ motif-containing protein contains PF05678: VQ motif Length = 311 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 392 STTGSNYYVRXLSTIDRELLKPSASVALHKHSNALVDVLPP 514 +TT ++Y+R L+ + ++ KP+ S + +N +D+ PP Sbjct: 25 NTTNRDHYLRQLNKLSHKISKPTNSSSSVSVANREIDLPPP 65 >At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A) (CDC48) identical to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana} Length = 809 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/61 (31%), Positives = 33/61 (54%) Frame = +2 Query: 431 TIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEI 610 +ID E+L A H H+ AL + P ++ E P+V ++DIGG++ K+E+ Sbjct: 439 SIDAEILNSMAVTNEHFHT-ALGNSNPSALRETVV-----EVPNVSWNDIGGLENVKREL 492 Query: 611 R 613 + Sbjct: 493 Q 493 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Frame = +2 Query: 179 ELESEDLYTKYKKLQRMLEFLEVQEE----YIKDEQRNLKKE 292 E E E + K ++L++ E++ Q E Y+KDE+ N+K+E Sbjct: 559 EAEWEHIDVKREELRKEAEYITRQREAFSMYLKDERDNIKEE 600 >At3g19670.1 68416.m02492 FF domain-containing protein / WW domain-containing protein weak similarity to huntingtin-interacting protein HYPA/FBP11 [Homo sapiens] GI:3341980; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 960 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/51 (25%), Positives = 33/51 (64%) Frame = +2 Query: 176 DELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQ 328 D LE ++ ++ +K+ + LE+ +EY++D +R +++ +EE+K+++ Sbjct: 581 DRLEVDERCSRLEKIDQ----LEIFQEYLRDLEREEEEKKKIQKEELKKVE 627 >At3g19370.1 68416.m02457 expressed protein Length = 704 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/67 (25%), Positives = 33/67 (49%) Frame = +2 Query: 122 MTKSQXSKGLAFAGPQSFDELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLH 301 MTK + + L +++ES++ KKL+ +E + E +K + N KE + Sbjct: 458 MTKDEIKRHLGLTKSDKVEKIESDEKQELRKKLEESVEKIRNLEAEMKTLREN--KEKVE 515 Query: 302 AQEEVKR 322 A+ E ++ Sbjct: 516 AEMETEK 522 >At5g40540.1 68418.m04920 protein kinase, putative similar to protein kinase ATN1 [Arabidopsis thaliana] gi|1054633|emb|CAA63387 Length = 353 Score = 27.9 bits (59), Expect = 6.2 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = +2 Query: 416 VRXLSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDT 595 +R LSTI L P A + N VLPPE+ + S++ +K + ++ Sbjct: 287 LRCLSTISSTELVPPAIKRVFSSENT---VLPPESPGTCSLMTVRDKDQIPTD----ANS 339 Query: 596 QKQEIRGS 619 + E+RGS Sbjct: 340 AQNEVRGS 347 >At3g62670.1 68416.m07040 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 426 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = +2 Query: 98 WNYFTRXKMTKSQXSK----GLAFAGPQSFDELESEDLY 202 W + R +M+KS K G + P +D+LE ++LY Sbjct: 151 WRHVYRKRMSKSGLDKPGESGTVESDPDEYDDLEQDNLY 189 >At2g41880.1 68415.m05179 guanylate kinase 1 (GK-1) identical to guanylate kinase (GK-1) [Arabidopsis thaliana] gi|7861795|gb|AAF70408 Length = 387 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 236 FLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVI 346 FLEV Y++++++ L+KE + + V+ P+VI Sbjct: 106 FLEVDSPYVREQKKLLRKEVVAWSKGVRGNAEKPIVI 142 >At2g27600.1 68415.m03346 AAA-type ATPase family protein / vacuolar sorting protein-related similar to SP|P46467 SKD1 protein (Vacuolar sorting protein 4b) {Mus musculus}; contains Pfam profiles PF00004: ATPase AAA family, PF04212: MIT domain Length = 435 Score = 27.9 bits (59), Expect = 6.2 Identities = 8/21 (38%), Positives = 18/21 (85%) Frame = +2 Query: 551 EKPDVQYSDIGGMDTQKQEIR 613 EKP++++SD+ G+++ KQ ++ Sbjct: 125 EKPNIKWSDVAGLESAKQALQ 145 >At1g77890.1 68414.m09078 expressed protein Length = 460 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 179 ELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEY 295 EL++E L +KLQ +E L+ + + RNLK+ Y Sbjct: 66 ELQNEKLAKLREKLQLQVEKLQQSKNTFRSLSRNLKERY 104 >At1g69910.1 68414.m08045 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -3 Query: 366 TASXNCPMTRGTDCMRFTSSCACKYSFFKFRCSSLMYSSCTSKNSNILWSFLYF 205 ++S +CP + F++S C + F+ +CSS S T N+ +S L++ Sbjct: 31 SSSFHCPPFNSSPPYPFSASPGCGHPNFQIQCSS---SRATITIKNLTFSILHY 81 >At1g47760.1 68414.m05311 MADS-box protein (AGL102) contains similarity to MADS-box protein GB:AAC26702 GI:3128222 from [Arabidopsis thaliana]; contains Pfam profile PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain) Length = 184 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 176 DELESEDLYTKYKKLQRMLEFL-EVQEEYIKDEQRNLKKEYLHAQEEVK 319 + +++ +K + L + LE + E QE+ K +QRNL+K + ++K Sbjct: 67 ERIQNPSASSKLRSLMKELEQIKEFQEDLRKKQQRNLEKSNMKENVDLK 115 >At5g03340.1 68418.m00286 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; supporting cDNA gi|26449351|dbj|AK117125.1| Length = 810 Score = 27.5 bits (58), Expect = 8.2 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +2 Query: 431 TIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEI 610 +ID E+L A H H+ AL + P ++ E P+V + DIGG++ K+E+ Sbjct: 439 SIDAEILNSMAVSNEHFHT-ALGNSNPSALRETVV-----EVPNVSWEDIGGLENVKREL 492 Query: 611 R 613 + Sbjct: 493 Q 493 >At4g21750.1 68417.m03148 L1 specific homeobox gene (ML1) / ovule-specific homeobox protein A20 nearly identical to meristem L1 layer homeobox protein A20 (AtML1) [Arabidopsis thaliana] GI:1881536, protodermal factor2 (PDF2) [Arabidopsis thaliana] GI:14276060 Length = 762 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 5/81 (6%) Frame = +2 Query: 326 QSVPLVIGQFXEAVDQNTGIVGSTTGSNYYVRXL---STIDRELLKPSASVALHK--HSN 490 +S+ L +G F + +TG VG GS+ +R + S D+ ++ A A+ + Sbjct: 216 RSLDLEVGNFGNNNNSHTGFVGEMFGSSDILRSVSIPSEADKPMIVELAVAAMEELVRMA 275 Query: 491 ALVDVLPPEADSSISMLQADE 553 D L +D+S+ +L +E Sbjct: 276 QTGDPLWVSSDNSVEILNEEE 296 >At1g29000.1 68414.m03546 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 287 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +2 Query: 185 ESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVK 319 E ED K ++ ++ E + +EE K E+ N KKE +EEVK Sbjct: 189 EEEDKKKKEEEDKKKKEDEKKKEEEKKKEEENKKKEGEKKKEEVK 233 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,904,965 Number of Sequences: 28952 Number of extensions: 209733 Number of successful extensions: 750 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -