BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1033 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00043-2|AAC77512.1| 242|Caenorhabditis elegans Set (trithorax/... 30 1.8 U41624-4|AAF99945.1| 322|Caenorhabditis elegans Hypothetical pr... 27 9.8 >U00043-2|AAC77512.1| 242|Caenorhabditis elegans Set (trithorax/polycomb) domaincontaining protein 1, isoform a protein. Length = 242 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +3 Query: 396 SEMRAHSTSSKNLLPSIENYIRNTRSTSSLMLRILFTFFRVRTENPKSKIQSRAMVKRCL 575 S + +HS+SS + PS R S + + FF+VR N K+ Q K L Sbjct: 34 SSLASHSSSSGRMTPSKNTRSRKGVSVKDVSNHKITEFFQVRRSNRKTSKQISDEAKHAL 93 Query: 576 K 578 + Sbjct: 94 R 94 >U41624-4|AAF99945.1| 322|Caenorhabditis elegans Hypothetical protein F46C8.7 protein. Length = 322 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = +3 Query: 438 PSIENYIRNTRSTSSLMLRILFTFFRVRTENPKSKIQS 551 P++++YI +TR + I FT+ R++T N ++++ Sbjct: 50 PALKHYIYDTRLSKIQKRAIRFTWHRLQTRNGGKRVEN 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,913,210 Number of Sequences: 27780 Number of extensions: 234855 Number of successful extensions: 450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -