BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1029 (810 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 27 0.90 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 25 3.7 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 26.6 bits (56), Expect = 0.90 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 31 LVLQKAEGYRTSLTAWVPDSW-SGD 102 LVLQ+ EGY T + ++P+ W SG+ Sbjct: 418 LVLQREEGYFTRPSEFMPERWLSGE 442 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 24.6 bits (51), Expect = 3.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 Query: 244 TLTYGAGRVRLPCLACKPRARMTSTSKNPFW*HIESWTSPSVVAPS 107 TL Y ++ P A + S ++ +W H +S +VVAPS Sbjct: 450 TLNYTQS-IQPPAHASGSHQQQASQQQSQYWPHGSGGSSSAVVAPS 494 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 806,845 Number of Sequences: 2352 Number of extensions: 16240 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -